Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Mucosal addressin cell adhesion molecule 1 (Madcam1)

Recombinant Rat Mucosal addressin cell adhesion molecule 1 (Madcam1)

Code: CSB-CF013308RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5300

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: 10xHis-SUMO-tag

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Madcam1

Uniprot NO.

O70540

Alternative Names

Madcam1Mucosal addressin cell adhesion molecule 1; MAdCAM-1; rMAdCAM-1

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

20-394

Target Protein Sequence

QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSSMVALWIGSLVLGLLALAFLAYCLWKRYRPGPLPDSSSCTLL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes.

Gene References into Functions

Immunohistochemical analysis of MAdCAM-1 expression during acute rejection on small bowel grafts in rats PMID:12034298
Treatment with an antibody to this antigen reduces glomerular and tubulointerstitial scarring in a rat model of crescentic glomerulonephritis PMID:12368200
Our model of chronic food allergy revealed that lymphocyte migration was increased with MAdCAM-1 upregulation. PMID:14670821
During small bowel allograft rejection., FTY720 was found to prevent the down-regulation of MAdCAM-1 expression in endothelial venules PMID:16387148