Recombinant Rat Interleukin-6 receptor subunit alpha (Il6r)

CSB-CF011665RA
Size:
20μg
20μg100μg
US$5809
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
Il6r
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
20-462
Target Protein Sequence
LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHWVYSGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVEILEGDKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGXPRWLKVSWQDPESWDPSYYLLQFELRYRPVWSKXFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFDIGQWSKWSPEVTGTPWLAEPRTTPAGIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPVQGSSPIPLPTFLVAGGSLAFGLLLCVFIILRLKKKWKSQAEKESKTTSPPPYPLGPLKPTFLLVPLLTPSGSHNSSGTDNTGSHSCLGVRDPQCPNDNSNRDYLFPR
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-phase reactions and hematopoiesis. The interaction with membrane-bound IL6R and IL6ST stimulates 'classic signaling', the restricted expression of the IL6R limits classic IL6 signaling to only a few tissues such as the liver and some cells of the immune system. Whereas the binding of IL6 and soluble IL6R to IL6ST stimulates 'trans-signaling'. Alternatively, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells.; Signaling via the membrane-bound IL6R is mostly regenerative and anti-inflammatory. Drives naive CD4(+) T cells to the Th17 lineage, through 'cluster signaling' by dendritic cells.; Soluble form of IL6 receptor (sIL6R) that acts as an agonist of IL6 activity. The IL6:sIL6R complex (hyper-IL6) binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL6R in a process called IL6 'trans-signaling'. sIL6R is causative for the proinflammatory properties of IL6 and an important player in the development of chronic inflammatory diseases. In complex with IL6, is required for induction of VEGF production. Plays a protective role during liver injury, being required for maintenance of tissue regeneration. 'Trans-signaling' in central nervous system regulates energy and glucose homeostasis.
Subcellular Location
[Interleukin-6 receptor subunit alpha]: Cell membrane; Single-pass type I membrane protein.; [Soluble interleukin-6 receptor subunit alpha]: Secreted.
Protein Families
Type I cytokine receptor family, Type 3 subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products