Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Interleukin-2 receptor subunit alpha (Il2ra)

Recombinant Rat Interleukin-2 receptor subunit alpha (Il2ra)

Code: CSB-CF011649RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4335

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Il2ra

Uniprot NO.

P26897

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

22-267

Target Protein Sequence

ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVASCIFLLLSILLLSGFTWQHRWRKSRRTI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.

Gene References into Functions

Adoptive transfusion of CD4+CD25+ (Interleukin-2 Receptor alpha) Regulatory T Cells into Experimental Autoimmune Neuritis model rats has significant therapeutic effects. PMID:29772575
Deletion of antigen-specific T cells by apoptosis and active suppression mediated by CD4(+)CD25(+) T-regulatory cells has an important role in the induction of antigen specific immune tolerance PMID:19884905

Hide All

Subcellular Location

Membrane; Single-pass type I membrane protein.

Database Links

UNIGENE: Rn.9872

KEGG: rno:25704

STRING: 10116.ENSRNOP00000066383

Promotions