Home
Product
Protein
Transmembrane Proteins
Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr)

Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr)

Code: CSB-CF009438RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5764

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Gipr

Uniprot NO.

P43219

Alternative Names

Gipr; Gastric inhibitory polypeptide receptor; GIP-R; Glucose-dependent insulinotropic polypeptide receptor

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

19-455

Target Protein Sequence

RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTAR VSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQVVY TVGYSLSLATLLLALLILSLFRRLHCTRNYIHMNLFTSFMLRAGAILTRDQLLPPLGPYT GNQTPTLWNQALAACRTAQILTQYCVGANYTWLLVEGVYLHHLLVVVRRSEKGHFRCYLL LGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIRTPILITILINFLIFIRILGIL VSKLRTRQMRCPDYRLRLARSTLTLMPLLGVHEVVFAPVTEEQAEGSLRFAKLAFEIFLS SFQGFLVSVLYCFINKEVQSEIRRLRLSLQEQCPRPHLGQAPRAVPLSSAPQEAAIRNAL PSGMLHVPGDEVLESYC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Gene References into Functions

glucose-dependent insulinotropic polypeptide and Glucose-dependent insulinotropic polypeptide receptors expression in the rat major salivary glands, as well as its variation in the rat SMG during the growth period PMID:24360021
Disruption of a signaling pathway may account for the lowered beta-cell GIP-R expression and resulting GIP resistance in type 2 diabetes. PMID:20332343
A novel pathway for downregulation of GIP receptor expression in Pancreatic beta Cells. PMID:12475913
The GIP receptor is expressed by cultured adult hippocampal progenitors and throughout the granule cell layer of the dentate gyrus, including progenitor cells. Thus, these cells have the ability to respond to GIP. PMID:15716418
Reduction of GLP-1 receptor expression by high glucose was prevented by dominant-negative protein kinase C (PKC)alpha. PMID:17360984
GIP-R is ubiquitinated, resulting in downregulation of the actions of GIP. PMID:17505054
These findings support the proposal that GIP receptor down-regulation in rodent T2DM is secondary to chronic hyperglycemia and that normalization of glycemia can restore GIP sensitivity. PMID:17803965

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 2 family

Tissue Specificity

Present in the pancreas as well as the gut, adipose tissue, heart, pituitary, and inner layers of the adrenal cortex, whereas it is not found in kidney, spleen, or liver. It is also expressed in several brain regions, including the cerebral cortex, hippoc

Database Links

UNIGENE: Rn.9676

KEGG: rno:25024

STRING: 10116.ENSRNOP00000021456

Promotions