Abbreviation
Recombinant Rat Gipr protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO), the EC50 is 26.97 - 33.90 ng/mL.
Alternative Names
Gastric inhibitory polypeptide receptor;GIP-R;Glucose-dependent insulinotropic polypeptide receptor;Gipr
Species
Rattus norvegicus (Rat)
Expression Region
19-135aa
Target Protein Sequence
RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Gipr at 2μg/mL can bind Anti-Mouse Gipr recombinant antibody (CSB-RA009438MA1MO), the EC50 is 26.97 - 33.90 ng/mL.
Description
GIPR mediates the insulinotropic effects of glucose-dependent insulinotropic polypeptide and represents a key target in metabolic disease research, yet studying its extracellular domain in isolation requires a system that preserves native glycosylation and disulfide architecture. This mammalian-expressed fragment spanning residues 19–135 captures the ligand-binding domain and demonstrates quantifiable binding activity in functional ELISA, achieving an EC50 of 26.97–33.90 ng/mL when immobilized at 2 μg/mL against a recombinant anti-GIPR antibody. The validated binding kinetics support its use in competitive inhibition assays, therapeutic antibody epitope mapping, and screening campaigns for biologics or small molecules targeting the GIP signaling axis. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for SPR-based affinity characterization, biolayer interferometry, and antibody validation workflows in obesity and diabetes research.