MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Gene References into Functions
The discovered changes in the expression level of catechol-o-methyltransferase , mineralocorticoid receptor , and b-subunit of epithelial sodium channel confirm their involvement in increased sympathetic stimulation of the of hypertensive ratsPMID:27215035
A higher hepatic COMT activity was found in the mineral water group compared with the tap water and tap-water-plus-NaCl groups. On the other hand, adrenal gland COMT mRNA expression decreased in the MW group compared to TW group.PMID:25560240
COMT inhibition results in increased pain sensitivity and production of proinflammatory mediators.PMID:24727346
Our findings suggest that COMT regulates dorsal hippocampal neurochemistry and modulates hippocampus-dependent behaviours.PMID:22815336
ZNF804a regulates expression of the schizophrenia-associated genes PRSS16, COMT, PDE4B, and DRD2PMID:22384243
decreased COMT activity was associated with some changes in feeding microstructure in rats and micePMID:21851556
investigation of substrate specificity and metabolite profiles of COMT from liver cytosol; studies include molecular modelingPMID:22071171
analysis of orientation and cellular distribution of membrane-bound catechol-O-methyltransferase in cortical neuronsPMID:21846718
In rat subarachnoid hemorrhage model could induce the expression of COMT in the rat striatum in the early stage.PMID:21116937
Reduction of COMT enzyme activity, and thereby possible accumulation of catecholamines, inhibits spinal nociceptive activity and attenuates the expression of spinal LTP.PMID:20219633
significant effects of hormone replacement and gonadectomy on catechol-O-methyltransferase and monoamine oxidase isoforms in both striatum and cortexPMID:19909795
These results suggest that the decreased expression of COMT may be an important factor leading to the development of hypertension.PMID:19966533
Contrary to expectations that COMT would be expressed predominantly in non-neuronal cells, the present study shows that neurons are the main cell populations expressing COMT mRNA in the rat forebrain.PMID:12535946
liver membrane-bound-catechol-O-methyltransferase may be a relevant factor in blood pressure regulation in ratsPMID:14714585
Strong COMT mRNA expression was observed in the suprachiasmatic nucleus throughout its rostrocaudal extent at postnatal day 1 (P1) and P2, and the mRNA levels decreased gradually until P16.PMID:15167541
Crystals diffract to 1.6 A resolution on a synchrotron-radiation source and belong to the monoclinic space group P2(1).PMID:16508109
These data provide the first direct evidence that low COMT activity leads to increased pain sensitivity via a beta(2/3)-adrenergic mechanism.PMID:17084978
Suppression of catechol-O-methyltransferase activities, decrease in degradation of norepinephrine (NE), and increase in NE release by blunting of alpha(2)-AR function may be involved in salt-sensitive hypertension in Dahl salt-sensitive rats.PMID:17510509
Catechol-O-methyltransferase activity and protein expression were increased in the substantia nigra after inflammation induced by lipopolysaccharides.PMID:17573159
Modulation of COMT activity may play a role in the regulation of myometrial contractility and cervical ripening during pregnancy.PMID:18042640
pI differences distinguishing between the various COMT forms are due to some as yet unidentified structural modification(s)PMID:18831714
This work reports the first crystallographic study of Rat COMT complexed with non-nitrocatechol inhibitor.PMID:19056347
The crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase were determined and compared.PMID:19111934
Show
More
Hide
All
Subcellular Location
[Isoform Soluble]: Cytoplasm.; [Isoform Membrane-bound]: Cell membrane; Single-pass type II membrane protein; Extracellular side.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family