Very nice to receive your inquiry.
We can provide several isoforms of this protein, please check the information as follows:
1.Also known as:Membrane-bound,MB-COMT
Recombinant Rat Catechol O-methyltransferase(Comt)
CSB-CF005779RA
Expression Region: 1-264aa; Provide the full length of Isoform 1, namely the full length of Membrane-bound form (Membrane-bound, MB-COMT)
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 10xHis-tagged)
Sequence:
MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
Reference: http://www.uniprot.org/uniprot/P22734
2.Also known as:Soluble,S-COMT
Recombinant Rat Catechol O-methyltransferase(Comt)
CSB-YP005779RA(F2) >> Yeast
CSB-EP005779RA(F2) >> E.coli
CSB-BP005779RA(F2) >> Baculovirus
CSB-MP005779RA(F2) >> Mammalian cell
Expression Region: 1-221aa;Provide the full length of Isoform 2, namely the full length of soluble form. (Soluble form, S-COMT)
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
MGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS
3.Recombinant Rat Catechol O-methyltransferase(Comt),partial
CSB-YP005779RA1 >> Yeast
CSB-EP005779RA1 >> E.coli
CSB-BP005779RA1 >> Baculovirus
CSB-MP005779RA1 >> Mammalian cell
Expression Region: 20-264aa; Partial, provide the complete extracellular domain of the Isoform 1.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
RHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS