Recombinant Rat Catechol O-methyltransferase (Comt), partial

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Comt
Uniprot NO.
Alternative Names
Comt; Catechol O-methyltransferase
Species
Rattus norvegicus (Rat)
Source
Yeast
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

Can you please provide the following information regarding CSB-EP005779RA1:
1) Is it a soluble form of the protein or membrane bound?
Please let me know if you have any additional questions.

A:
Very nice to receive your inquiry.
We can provide several isoforms of this protein, please check the information as follows:
1.Also known as:Membrane-bound,MB-COMT
Recombinant Rat Catechol O-methyltransferase(Comt)
CSB-CF005779RA
Expression Region: 1-264aa; Provide the full length of Isoform 1, namely the full length of Membrane-bound form (Membrane-bound, MB-COMT)
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 10xHis-tagged)
Sequence:

MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS


Reference: http://www.uniprot.org/uniprot/P22734
2.Also known as:Soluble,S-COMT
Recombinant Rat Catechol O-methyltransferase(Comt)
CSB-YP005779RA(F2) >> Yeast
CSB-EP005779RA(F2) >> E.coli
CSB-BP005779RA(F2) >> Baculovirus
CSB-MP005779RA(F2) >> Mammalian cell
Expression Region: 1-221aa;Provide the full length of Isoform 2, namely the full length of soluble form. (Soluble form, S-COMT)
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

MGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS


3.Recombinant Rat Catechol O-methyltransferase(Comt),partial
CSB-YP005779RA1 >> Yeast
CSB-EP005779RA1 >> E.coli
CSB-BP005779RA1 >> Baculovirus
CSB-MP005779RA1 >> Mammalian cell
Expression Region: 20-264aa; Partial, provide the complete extracellular domain of the Isoform 1.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

RHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS


Target Background

Function(From Uniprot)
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Gene References into Functions
  1. The discovered changes in the expression level of catechol-o-methyltransferase , mineralocorticoid receptor , and b-subunit of epithelial sodium channel confirm their involvement in increased sympathetic stimulation of the of hypertensive rats PMID:27215035
  2. A higher hepatic COMT activity was found in the mineral water group compared with the tap water and tap-water-plus-NaCl groups. On the other hand, adrenal gland COMT mRNA expression decreased in the MW group compared to TW group. PMID:25560240
  3. COMT inhibition results in increased pain sensitivity and production of proinflammatory mediators. PMID:24727346
  4. Our findings suggest that COMT regulates dorsal hippocampal neurochemistry and modulates hippocampus-dependent behaviours. PMID:22815336
  5. ZNF804a regulates expression of the schizophrenia-associated genes PRSS16, COMT, PDE4B, and DRD2 PMID:22384243
  6. decreased COMT activity was associated with some changes in feeding microstructure in rats and mice PMID:21851556
  7. investigation of substrate specificity and metabolite profiles of COMT from liver cytosol; studies include molecular modeling PMID:22071171
  8. analysis of orientation and cellular distribution of membrane-bound catechol-O-methyltransferase in cortical neurons PMID:21846718
  9. In rat subarachnoid hemorrhage model could induce the expression of COMT in the rat striatum in the early stage. PMID:21116937
  10. Reduction of COMT enzyme activity, and thereby possible accumulation of catecholamines, inhibits spinal nociceptive activity and attenuates the expression of spinal LTP. PMID:20219633
  11. significant effects of hormone replacement and gonadectomy on catechol-O-methyltransferase and monoamine oxidase isoforms in both striatum and cortex PMID:19909795
  12. These results suggest that the decreased expression of COMT may be an important factor leading to the development of hypertension. PMID:19966533
  13. Contrary to expectations that COMT would be expressed predominantly in non-neuronal cells, the present study shows that neurons are the main cell populations expressing COMT mRNA in the rat forebrain. PMID:12535946
  14. liver membrane-bound-catechol-O-methyltransferase may be a relevant factor in blood pressure regulation in rats PMID:14714585
  15. Strong COMT mRNA expression was observed in the suprachiasmatic nucleus throughout its rostrocaudal extent at postnatal day 1 (P1) and P2, and the mRNA levels decreased gradually until P16. PMID:15167541
  16. Crystals diffract to 1.6 A resolution on a synchrotron-radiation source and belong to the monoclinic space group P2(1). PMID:16508109
  17. These data provide the first direct evidence that low COMT activity leads to increased pain sensitivity via a beta(2/3)-adrenergic mechanism. PMID:17084978
  18. Suppression of catechol-O-methyltransferase activities, decrease in degradation of norepinephrine (NE), and increase in NE release by blunting of alpha(2)-AR function may be involved in salt-sensitive hypertension in Dahl salt-sensitive rats. PMID:17510509
  19. Catechol-O-methyltransferase activity and protein expression were increased in the substantia nigra after inflammation induced by lipopolysaccharides. PMID:17573159
  20. Modulation of COMT activity may play a role in the regulation of myometrial contractility and cervical ripening during pregnancy. PMID:18042640
  21. pI differences distinguishing between the various COMT forms are due to some as yet unidentified structural modification(s) PMID:18831714
  22. This work reports the first crystallographic study of Rat COMT complexed with non-nitrocatechol inhibitor. PMID:19056347
  23. The crystal structures of the Apo and Holo form of rat catechol-O-methyltransferase were determined and compared. PMID:19111934

Show More

Hide All

Subcellular Location
[Isoform Soluble]: Cytoplasm.; [Isoform Membrane-bound]: Cell membrane; Single-pass type II membrane protein; Extracellular side.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
Database Links

UNIGENE: Rn.220

KEGG: rno:24267

STRING: 10116.ENSRNOP00000043148

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1