Home
Product
Protein
Transmembrane Proteins
Recombinant Rat C3a anaphylatoxin chemotactic receptor (C3ar1)

Recombinant Rat C3a anaphylatoxin chemotactic receptor (C3ar1)

Code: CSB-CF003889RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6034

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

C3ar1

Uniprot NO.

O55197

Alternative Names

C3ar1; C3a anaphylatoxin chemotactic receptor; C3AR; C3a-R

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

1-473

Target Protein Sequence

MESFTADTNSTDLHSRPLFKPQDIASMVILSLTCLLGLPGNGLVLWVAGVKMKRTVNTVW FLHLTLADFLCCLSLPFSVAHLILRGHWPYGLFLCKLIPSVIILNMFASVFLLTAISLDR CLMVHKPIWCQNHRSVRTAFAVCGCVWVVTFVMCIPVFVYRDLLVVDDYSVCGYNFDSSR AYDYWDYMYNSHLPEINPPDNSTGHVDDRTAPSSSVPARDLWTATTALQSQTFHTSPEDP FSQDSASQQPHYGGKPPTVLIATIPGGFPVEDHKSNTLNTGAFLSAHTEPSLTASSSPLY AHDFPDDYFDQLMYGNHAWTPQVAITISRLVVGFLVPFFIMITCYSLIVFRMRKTNLTKS RNKTLRVAVAVVTVFFVCWIPYHIVGILLVITDQESALREVVLPWDHMSIALASANSCFN PFLYALLGKDFRKKARQSVKGILEAAFSEELTHSTSCTQDKAPSKRNHMSTDV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.

Gene References into Functions

C5aR and C5L2, but not C3aR, are expressed on CD11b-positive leukocytes in islet preparations PMID:22099750
The C3 and C3a receptor system may primarily be involved in the pathogenesis of renal remodeling in hypertensive rats. PMID:23713944
The binding of TLQP-21 to C3AR1 not only has effects on signaling but also modulates cellular functions PMID:23940034
results provide the first evidence that C3aR and C5aR are both expressed in cerebellar granule cells during development and that C5a, but not C3a, is a potent inhibitor of apoptotic cell death in cultured granule neurons PMID:15292245
Role of C3ar1 in the development of the rat cerebellum is reported. PMID:18635264