Recombinant Rat Amphiregulin (Areg)

Code: CSB-CF001986RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3594

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Areg

Uniprot NO.

P24338

Alternative Names

Areg; Sdgf; Amphiregulin; AR; Schwannoma-derived growth factor; SDGF

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

97-243

Target Protein Sequence

VIKPKENKTEGEKSSEKPKRKKKGGKGGKGRRNRKKKKNPCAAKFQNFCIHGECRYIENLEVVTCHCHQDYFGERCGEKTMKTQKKDDSDLSKIALAAIIVFVSAVSVAAIGIITAVLLRKRFFREYEEAEERRRLRQENGTAHAIA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.

Gene References into Functions

Report increased AREG transcript and protein levels in the lungs of rodents with DA-induced bronchiolitis obliterans. PMID:24816162
estrogen and progeterone increased cell proliferation in normal gland and mammary cancers through the increased production of amphiregulin PMID:21258428
may play a role in the ovulatory process of cycling rats as well as in the induction of ovulation in immature rats PMID:15291759
the expression of amphiregulin (AR), a member of the epidermal growth factor (EGF) family, is rapidly and highly up-regulated by PTH in several osteoblastic cell lines and bone tissues PMID:15509566
findings identify Amphiregulin as a factor for resistance of glioma cells to delta9-Tetrahydrocannabinol induced apoptosis PMID:19229996