QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNPAGLAPGTVASIILTLVLLVVLLAMCGPLVYKKLVKKFRQKKQRQWIGPTGVNQNMSFHRSHTATVRSQVENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSTQPDNSSDSDYDLQVAQRL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
May act as a receptor in regulating T-cell proliferation.
Gene References into Functions
The natural substrate for the cell surface sialidase was identified as clustered differentiation 5 (CD5) by PNA-blot analysis of anti-CD5 immunoprecipitate.PMID:29897583
FasL expression in splenic CD5(+)CD1d(hi) B cells was decreased compared to the control group after TLR4 ligation.PMID:28505514
CD5-CK2 signaling axis regulates positive selection by modulating activation of ERK and promoting survival independent of proximal TCR signalsPMID:28030587
the reduction in the positive selection conferred by CD5 overexpression was unaffected by SHP-1 deficiency.PMID:27221212
In mice lacking functional KDELR1, surviving naive T cells expressed significantly higher levels of CD5, a surrogate marker of TCR self-reactivity.PMID:26489882
In mouse tumor models, CD5(+) but not CD5(-) B cells promoted tumor growth. The results demonstrate a critical role of CD5(+) B cells in promoting cancer.PMID:27096320
CD5 and CD72 play a critical role in maintaining regulatory T and B cell homeostasisPMID:24950378
CD5 promoted Treg cell induction in response to self and tolerizing antigens by blocking mTOR activation.PMID:25786177
Data indicate that CD5-casein kinase 2 (CK2) signaling is necessary for efficient nuclear localization of orphan nuclear receptor ROR-gammaT (RORgammat).PMID:24356888
Although the percentage of CD1d(hi)CD5+ subset in splenic B cells does not change significantly, percent IL-10-expressing cells among total splenic B cells or the CD1dhiCD5+ population significantly increases 3-7 days after rCRT/39-272 administrationPMID:23523122
Different CD5 expression levels influence the proliferation dynamics of activated naive CD4+ T cells while leaving the conversion rate of those cells into memory cells unaffected.PMID:23100516
CD5 glycoprotein-mediated T cell inhibition dependent on inhibitory phosphorylation of Fyn kinasePMID:21757751
Delayed tumor growth in CD5-deficient mice is associated with enhanced activation of tumor-infiltrating lymphocytes due to an upregulated T cell response to T cell receptor (TCR) stimulation.PMID:21622855
A conserved enhancer element differentially regulates developmental expression of CD5 in B and T cells.PMID:21076064
Absence of CD5 dramatically reduces progression of pulmonary inflammatory lesions in SHP-1 protein-tyrosine phosphatase-deficient 'viable motheaten' mice.PMID:11908943
CD5, an important regulator of lymphocyte selection and immune tolerance. Review.PMID:12403363
CD5 is rapidly recruited at the immunological synapse (IS) and lowers the T cell response elicited by antigen presentation by targeting downstream signaling events without affecting IS formation.PMID:12707340
The mechanism that mediates this dynamic antigen-specific T cell unresponsiveness differs from previously described forms of tolerance in that it requires that DCs induce CD5 expression on activated T cellsPMID:15189735
a direct role for CD5-CK2 pathway in T cell activation and persistence of effector T cells in neuroinflammatory diseasePMID:17142752
Ly-1 antibody reactive Embryonic stem cells functions to control the stability of nucleolin protein, which in turn is essential for maintaining their self-renewalPMID:19489080
Data provide new evidence supporting a potential role of CD5 in thymocyte survival, through a mechanism that may involve the phosphorylation of Akt.PMID:19609976
Reduced numbers of splenic FasL+ CD5+ B cells correlated with increasing arthritis severity and decreased T-cell death in a T-cell receptor transgenic mouse model of collagen-induced arthritis.PMID:19706160
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.