Recombinant Mouse T-cell surface glycoprotein CD5 (Cd5), partial, Biotinylated

Code: CSB-MP004942MOk7-B
Size:
20ug
20ug100ug1mg
US$166
Quantity:
Express system: Mammalian cell
Species: Mus musculus (Mouse)
Tag Info: C-terminal 10xHis-Avi-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Cd5 protein, partial, Biotinylated
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
Cd5
Uniprot NO.
Research Area
Immunology
Alternative Names
Lymphocyte antigen 1
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
24-371aa
Target Protein Sequence
QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.4 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of Cd5 was greater than 95% as determined by SEC-HPLC

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May act as a receptor in regulating T-cell proliferation.
Gene References into Functions
  1. The natural substrate for the cell surface sialidase was identified as clustered differentiation 5 (CD5) by PNA-blot analysis of anti-CD5 immunoprecipitate. PMID:29897583
  2. FasL expression in splenic CD5(+)CD1d(hi) B cells was decreased compared to the control group after TLR4 ligation. PMID:28505514
  3. CD5-CK2 signaling axis regulates positive selection by modulating activation of ERK and promoting survival independent of proximal TCR signals PMID:28030587
  4. the reduction in the positive selection conferred by CD5 overexpression was unaffected by SHP-1 deficiency. PMID:27221212
  5. In mice lacking functional KDELR1, surviving naive T cells expressed significantly higher levels of CD5, a surrogate marker of TCR self-reactivity. PMID:26489882
  6. In mouse tumor models, CD5(+) but not CD5(-) B cells promoted tumor growth. The results demonstrate a critical role of CD5(+) B cells in promoting cancer. PMID:27096320
  7. CD5 and CD72 play a critical role in maintaining regulatory T and B cell homeostasis PMID:24950378
  8. CD5 promoted Treg cell induction in response to self and tolerizing antigens by blocking mTOR activation. PMID:25786177
  9. Data indicate that CD5-casein kinase 2 (CK2) signaling is necessary for efficient nuclear localization of orphan nuclear receptor ROR-gammaT (RORgammat). PMID:24356888
  10. Although the percentage of CD1d(hi)CD5+ subset in splenic B cells does not change significantly, percent IL-10-expressing cells among total splenic B cells or the CD1dhiCD5+ population significantly increases 3-7 days after rCRT/39-272 administration PMID:23523122
  11. Different CD5 expression levels influence the proliferation dynamics of activated naive CD4+ T cells while leaving the conversion rate of those cells into memory cells unaffected. PMID:23100516
  12. CD5 glycoprotein-mediated T cell inhibition dependent on inhibitory phosphorylation of Fyn kinase PMID:21757751
  13. Delayed tumor growth in CD5-deficient mice is associated with enhanced activation of tumor-infiltrating lymphocytes due to an upregulated T cell response to T cell receptor (TCR) stimulation. PMID:21622855
  14. A conserved enhancer element differentially regulates developmental expression of CD5 in B and T cells. PMID:21076064
  15. Absence of CD5 dramatically reduces progression of pulmonary inflammatory lesions in SHP-1 protein-tyrosine phosphatase-deficient 'viable motheaten' mice. PMID:11908943
  16. CD5, an important regulator of lymphocyte selection and immune tolerance. Review. PMID:12403363
  17. CD5 is rapidly recruited at the immunological synapse (IS) and lowers the T cell response elicited by antigen presentation by targeting downstream signaling events without affecting IS formation. PMID:12707340
  18. The mechanism that mediates this dynamic antigen-specific T cell unresponsiveness differs from previously described forms of tolerance in that it requires that DCs induce CD5 expression on activated T cells PMID:15189735
  19. a direct role for CD5-CK2 pathway in T cell activation and persistence of effector T cells in neuroinflammatory disease PMID:17142752
  20. Ly-1 antibody reactive Embryonic stem cells functions to control the stability of nucleolin protein, which in turn is essential for maintaining their self-renewal PMID:19489080
  21. Data provide new evidence supporting a potential role of CD5 in thymocyte survival, through a mechanism that may involve the phosphorylation of Akt. PMID:19609976
  22. Reduced numbers of splenic FasL+ CD5+ B cells correlated with increasing arthritis severity and decreased T-cell death in a T-cell receptor transgenic mouse model of collagen-induced arthritis. PMID:19706160

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Database Links

UNIGENE: Mm.779

KEGG: mmu:12507

STRING: 10090.ENSMUSP00000025571

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products