MTSGPFFFCIFIIGKYFTLGSAQDVSCPLGSFPCGNMSRCLPQLLHCNGVDDCGNRADED HCGDNNGWSLQLDKYFANYYKLASTNSFEAETSECLVGSVPMHCLCRDLELDCDEANLRA VPSVSSNVTVMSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIHSVSVSAFRGLRSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINYLNEHAFTHLQKLDEL DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDCLAKLKSLSLEGIEISNIQQ RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC FGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGVYLFVIGAFDLKFRGEYNKHAQPWM ESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTITVLIFIWIIGF IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG SMFYSVHQSSVTVTEIQKQVKKEVVLAKRFFFIVFTDALCWIPIFILKFLSLLQVEIPDS ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWHNYRQRRSVDRKETQKAYAPSFIW VEMWPLQEMSSGFMKPGAFTDPCDLSLVSQSSRLNSYS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.
Gene References into Functions
No differences were found in RXFP1 expression related to aging.PMID:26109313
Colonic tissue expresses RXFP1 in smooth muscle cells of the muscular wall and in neurons of the myenteric plexus.PMID:26360621
relaxin/RXFP1 signaling in smooth muscle cells is important for normal collagen turnover and relaxation of the pubic symphysis during pregnancyPMID:25715795
maternal exposure to simazine causes disturbed relaxin signaling pathway and testicular dysfunctionPMID:22984576
H3 relaxin exerts antifibrotic actions via RXFP1 receptorPMID:21229994
The downregulation of RXFP1 resulted in significant decrease in metastasis rate in PC3 tumors.PMID:20861284
Rxfp1 acts in an autocrine and/or paracrine fashion upstream of PCDHY in regulating increased canonical Wnt signaling in prostate cancer.PMID:20503398
mouse and rat LGR7 are the relaxin receptors in these speciesPMID:15566402
Mouse and rat LGR7 were able to bind to and be activated by relaxin ligandsPMID:15956680
LGR7-Truncate is potentially an endogenous regulator of LGR7 signalingPMID:15956683
gene expression profiling of Lgr7 in the adult mouse brainPMID:15956708
expression of lgr7 in mouse brain membranes and neuronsPMID:15956710
Inhibition of androgen-independent growth was also achieved by blocking expression of LGR7, the cognate receptor of H2 relaxinPMID:16434975
LGR7-expressing cells in the stroma are both necessary and sufficient for relaxin to promote proliferation and inhibit apoptosis in both stromal and epithelial cells of cervix and vagina.PMID:18218691
RXFP1 is involved in mediating relaxin's effects on airway fibrosis during homeostasis but not during inflammation-induced fibrosis associated with chronic allergic airways disease.PMID:18974264
Data show that cardiac RXFP1 expression increased in hearts of transgenic mice with cardiomyocyte-restricted overexpression of alpha1A-AR, alpha1B-AR, or beta2-AR, demonstrating distinct regulation by adrenergic signaling of cardiac RXFP1 expressionPMID:19416204