Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse Membrane cofactor protein (Cd46)

Recombinant Mouse Membrane cofactor protein (Cd46)

Code: CSB-CF004939MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4896

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: 10xHis-SUMO-tag

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cd46

Uniprot NO.

O88174

Alternative Names

Cd46; McpMembrane cofactor protein; CD antigen CD46

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

45-365

Target Protein Sequence

CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAWIIALIVITSIVGVFILCLIVLRCFEHRKKTNVSAAR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Gene References into Functions

Changes in CD46 expression may lead to changes in VEGF and play a pathologic role in the development of age-related macular degeneration. PMID:26161984
Our findings provide evidence for expression of CD46 in the mouse eye and a role for CD46 in protection against laser-induced choroidal neovascularization PMID:25019227
This fusion is mediated by the interaction between viral glycoproteins expressed on the membrane of the infected cells and CD46 on the glial targets, and is also observed using cells expressing recombinant MV glycoproteins. PMID:15920733
CD46 isoforms function as receptors for human herpesvirus 6 and measles virus PMID:12171934
Disruption of mouse CD46 causes an accelerated spontaneous acrosome reaction in sperm and increased male fertility PMID:12640142
CD46 has a role as a receptor for fusion and entry of human herpesvirus 6 into target cells PMID:12724329

Hide All

Subcellular Location

[Isoform 1]: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein. Note=Inner acrosomal membrane of spermatozoa.; [Isoform 2]: Secreted.

Tissue Specificity

Present only in testis (at protein level).

Database Links

UNIGENE: Mm.12884

KEGG: mmu:17221

STRING: 10090.ENSMUSP00000123931

Promotions