Recombinant Mouse Leukocyte antigen CD37 (Cd37)

Code: CSB-CF713974MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4597

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cd37

Uniprot NO.

Q61470

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-281

Target Protein Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWILIDKTSFVSFVGLSFVPLQTWSKV LAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQ ELVLRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANESEEPFVPCS CYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHN NIISIVGICLGVGLLELGFMTLSIFLCRNLDHVYDRLARYR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Gene References into Functions

CD37 may protect against IgA nephropathy by inhibition of the IL-6 pathway. PMID:29551516
this study identifies CD37 as a tumor suppressor that directly protects against B cell lymphomagenesis PMID:26784544
The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model. PMID:24445867
The cellular defect that underlies poor cellular immune induction in CD37-defcient mice is impaired dendritic cell migration. PMID:23420539
CD37 was required for the mobility and clustering of alpha(4)beta(1) integrins in the plasma membrane, thus regulating the membrane distribution of alpha(4)beta(1) integrin necessary for activation of the Akt survival pathway PMID:23150881
CD37 protects against glomerular IgA deposition and renal pathology PMID:20348240
The influence of CD37 in the early events of T cell receptor signaling demonstrates a regulatory role for CD37 in T cell proliferation. PMID:14978098
tetraspanin protein CD37 inhibits IgA responses and regulates the anti-fungal immune response. PMID:19282981