GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLYIIYTVGYALSFSALVIASAILVGFRHLHCTRNYIHLNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAANYYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRNSNMNYWLIIRLPILFAIGVNFLIFIRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLLGTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQMEFRKCWERWRLEHLNIQRDCSMKPLKCPTSSVSSGATVGSSVYAATCQSSYS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G-protein coupled receptor for glucagon-like peptide 1 (GLP-1). Ligand binding triggers activation of a signaling cascade that leads to the activation of adenylyl cyclase and increased intracellular cAMP levels. Plays a role in regulating insulin secretion in response to GLP-1.
Gene References into Functions
Study shows that GLP-1 receptor signalling promotes beta-cell glucose metabolism via mTOR-dependent HIF-1alpha activation. findings suggest that chronic GLP-1 actions on insulin secretion include elevated beta-cell glucose metabolism. Moreover, our data reveal novel aspects of GLP-1 stimulated insulin secretion involving de novo gene expression.PMID:28572610
chronotherapeutic modulation of vagal afferent GLP-1R signaling may aid in treating metabolic disorders.PMID:29317623
Presynaptic GLP-1 receptors enhance the depolarization-evoked release of glutamate and GABA in the mouse cortex and hippocampus.PMID:29265673
This study presents an unexpected proinflammatory switch from Galphas to GalphaI glp1r signaling in burn monocytes which promotes ERK1/2 and NF-kappaB activationPMID:29022064
GLP-1R signaling in paraventricular thalamic nucleus plays a role in food intake control.PMID:28811669
GLP-1 receptor agonists suppress the progression of atherosclerosis by inhibiting vascular smooth muscle cell proliferation and enhancing AMP-activated protein kinase and cell cycle regulation in ApoE deficient mice.PMID:28445811
IL-33, GLP-1R, and CCL20 are deregulated in human inflammatory bowel disease. GLP-1 receptor agonists upregulate IL-33, mucin 5b, and CCL20 in murine Brunner's glands. GLP-1 receptor agonists affect gut homeostasis in both proximal and distal parts of the gut.PMID:27542128
findings identify a group of proteins that interact with GLP-1R and show that one specific interacting protein, SERP1, has an important role in facilitating the glycosylation of GLP-1R and rescuing its activities after ER stress induced by tunicamycin.PMID:28597972
Suggest transcription factor 7-like 2 is a possible regulator of glucagon-like peptide 1 receptor expression in endothelial/smooth muscle cells in diabetic mice.PMID:28830217
ventromedial hypothalamus GLP-1R regulates food intake by engaging key nutrient sensors but is dispensable for the effects of GLP-1RA on nutrient homeostasisPMID:28811293
GLP-1R is highly expressed within the lateral septum.PMID:27187231
Study showe that GLP-producing fibers interact with hypothalamic arcuate nucleus (ARC) Kiss1 cells that express GLP-1R, and GLP-1R signaling directly activates ARC Kiss1 function in an estradiol-independent manner. Pharmacological activation of GLP-1R signaling during fasting or pharmacological inhibition of CNS GLP-1R signaling during normal feeding does not alter circulating luteinizing hormone levels.PMID:28144621
The increased calcium response mediated by secretin in the absence of GLP-1R was paralleled by an increased glucose-dependent insulin response, indicating that the heterodimeric receptor complexes modulate secretin responses.PMID:28368447
Menin and PRMT5 suppress GLP1R transcript levels and PKA-mediated phosphorylation of FOXO1 and CREB.PMID:28270438
Enhanced beta-cell GLP-1R signaling contributes to improved glucose regulation after vertical sleeve gastrectomy by promoting increased glucose-stimulated insulin secretion.PMID:27501183
Results suggest a detectable but only modest role for GLP-1R signaling in mediating the effects of Roux-en-Y gastric bypass and that this role is limited to its well-described action on glucose regulation.PMID:27026085
Hypothalamic Glp1r is sufficient but not necessary for regulation of energy balance and glucose homeostasis.PMID:27908915
Genetic deletion of both GLP-1 and GIP receptors reveals that they are required to maintain an adequate islet number in adulthood and to maintain normal beta cell responses to glucose.PMID:27020250
present study provides critical insights regarding the nature by which GLP-1 signaling controls reinforced behaviors and underscores the importance of both peripheral and central GLP-1R signaling for the regulation of addictive disorders.PMID:27072507
These differential effects of exogenous Glp1r in nondiabetic and diabetic mice suggest that downregulation of Glp1r might be required to slow the progression of beta-cell failure under diabetic conditions.PMID:26854076
although endogenous GLP-1R signalling contributes to increased brown adipose tissue thermogenesis, this mechanism does not play a significant role in the food intake-independent body weight lowering effect of the GLP-1 mimetic liraglutide in obese micePMID:26049402
GLP-1R is present in pancreatic acinar cells and that GLP-1 can regulate secretion through its receptor and cAMP signaling pathway.PMID:26542397
GLP1R is expressed in mouse retina. GLP-1R protein abundance was independent of the presence of diabetes.PMID:26384381
The data of this study reveal a novel role of GLP-1R in dorsal lateral septum function driving behavioral responses to cocaine.PMID:25669605
GLP-1R agonism significantly reduced alcohol consumption in a mouse model of alcohol dependence.PMID:26080318
these data provide novel evidence that lipotoxicity decreases the mesangial GLP-1R expression in intact cells and in vivo.PMID:26302449
These results support a role for extra islet GLP1R in oral glucose tolerance and paracrine regulation of beta cells by islet GLP-1.PMID:24836562
For the binding between 125I-liraglutide and the GLP-1 receptor on the surface of INS-1 cells, the equilibrium dissociation constant (Kd) was 128.8 +/- 30.4 nmol/L(N = 3), and the half-inhibition concentration (IC50) was 542.4 +/- 187.5 nmol/L(N = 3).PMID:24805918
GLP-1 receptors are located in the renal vasculature, including afferent arterioles. Activation of these receptors reduces the autoregulatory response of afferent arterioles to acute pressure increases and increases RBF in normotensive rats.PMID:25656368
our data demonstrate that the expression of GLP-1R and GIPR is regulated by glucose concentrations in MC3T3-E1 cells undergoing differentiation induced by BMP-2.PMID:24866833
GLP-1R on POMC/CART-expressing ARC neurons likely mediates liraglutide-induced weight lossPMID:25202980
GLP-1R signaling upregulates renal NAD(P)H oxidase and increases renal oxidative stress, with reduced levels of renal cAMP-PKA activity in the setting of chronic hyperglycemia accentuating the progression of diabetic nephropathy.PMID:24152968
Activation of GLP-1R in spinal cord leads to antinociception in pain hypersensitivity.PMID:25247855
GLP-1R is shown to be a recycling receptor.PMID:24275181
Binding of the novel ligand [125I]GLP-1(9-36) is studied in mouse tissues as well as the parameters of equilibrium dissociation constant, functional activity, and GLP-1 receptor density, compared with GLP-1(7-36).PMID:24641952
Exenatide requires a functional GLP-1R to exert chronic metabolic effects in mice.PMID:24477544
Our findings indicate that the GLP-1r is involved in ileal enterocyte and Paneth cell functionPMID:23927844
The results provide no support for important individual roles of either gut hormone in the specific mechanisms by which RYGB rats settle at a lower body weight.PMID:24430883
A novel GLP-1R-protein interactome was generated, identifying several interactors that suppress GLP-1R signaling.PMID:23864651
mice lacking GLP1R appear to have decreased bone strength observed at anatomical level with decrease in 3-point bending resistance and decreased Ct.Th. Bone strength was reduced at tissue level and was associated with reductions of collagen cross-linkingPMID:23911987
GLP-1R agonism reverses cardiac remodeling and dysfunction observed in T2DM via normalizing imbalance of lipid metabolism and related inflammation/oxidative stress.PMID:23709595
there is a gut-heart GLP-1R-dependent and ANP-dependent axis that regulates blood pressure and involves Epac2PMID:23542788
Functional disruption of the Glp1r results in exercise-induced hyperglycaemia associated with an excessive increase in glucagon secretion and hepatic glucose productionPMID:22890715
Activation of the central GLP-1R reduces food intake via glucose metabolism-dependent inhibition of central AMPK. Fructose stimulates food intake by impairing central GLP-1R action.PMID:23341495
GLP-1 receptor activation inhibits VLDL production and reverses hepatic steatosis by decreasing hepatic lipogenesis in high-fat-fed APOE*3-Leiden micePMID:23133675
Data suggest that both glucagon-like peptide 1/Glp1r signal transduction and glucagon receptor activity in central nervous system are involved in control of interscapular brown adipose tissue thermogenesis.PMID:22933116
GLP-1 and liraglutide activate the GLP-1R, thereby promoting pre-adipocyte proliferation and inhibition of apoptosis.PMID:22207759
C-cell effects in mice are mediated via the GLP-1 receptor and not associated with RET activationPMID:22234463
low levels of endogenous GLP-1 secreted from gut endocrine cells are capable of augmenting glucoregulatory activity via pancreatic GLP-1Rs independent of communication with neural pathwaysPMID:22182839
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Detected in pancreatic islets (at protein level). Detected in pancreatic islets and lungs.