Abbreviation
Recombinant Mouse Glp1r protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/mL can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA3HU). The EC50 is 141.7-172.4 ng/mL.
Alternative Names
Glucagon-like peptide 1 receptor; GLP-1 receptor; GLP-1-R; GLP-1R;Glp1r
Species
Mus musculus (Mouse)
Expression Region
22-145aa
Target Protein Sequence
GPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPWRDLSECEESKRGERNFPEEQLLSLY
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Glp1r at 2 μg/ml can bind Anti-GLP1R recombinant antibody (CSB-RA009514MA3HU). The EC50 is 141.7-172.4 ng/mL.
Description
GLP-1R mediates incretin signaling central to glucose homeostasis and is a validated target for metabolic disease therapeutics, yet studying its extracellular domain in isolation requires a protein that preserves native epitope presentation. This mammalian-expressed fragment spanning residues 22–145 captures the N-terminal ligand-binding domain and demonstrates functional binding to an anti-GLP1R recombinant antibody with an EC50 of 141.7–172.4 ng/mL in ELISA, confirming conformational integrity suitable for antibody epitope mapping, competitive inhibition screening, and therapeutic antibody validation studies. The low endotoxin level (< 1.0 EU/μg) and > 90% purity meet the quality thresholds commonly required for surface plasmon resonance and biolayer interferometry experiments characterizing receptor-ligand affinity or screening small-molecule modulators. Researchers developing GLP-1R-targeted biologics or investigating incretin receptor pharmacology can use this protein as a positive control in binding assays or as an immobilized ligand for drug discovery campaigns.
