Home
Product
Protein
Transmembrane Proteins
Recombinant Mouse G-protein coupled receptor family C group 5 member B (Gprc5b)

Recombinant Mouse G-protein coupled receptor family C group 5 member B (Gprc5b)

Code: CSB-CF835660MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5353

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Gprc5b

Uniprot NO.

Q923Z0

Alternative Names

Gprc5b; Raig2; G-protein coupled receptor family C group 5 member B; Retinoic acid-induced gene 2 protein; RAIG-2

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

29-410

Target Protein Sequence

ENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKDKE RKRPVCLHFLFLLGTLGLFGLTFAFIIQMDETICSIRRFLWGVLFALCFSCLLSQAWRVR RLVRQGTSPASWQLVSLALCLMLVQVIIATEWLVLTVLRDTKPACAYEPMDFVMALIYDM VLLAITLAQSLFTLCGKFKRWKVNGAFILVTTFLSALIWVVWMTMYLFGNSLIKQGDAWS DPTLAITLAASGWVFVIFHAIPEIHYTLLPPLQENPPNYFDTSQPRMRETAFDEEMHLPR AYMENKAFSMDEHNAALRSAVGFSNGSLEQRSSSLGKKPSSLGNRPSAPFRSNVYQPTEM AVVLNGGTIPTAPPSHTGRHHW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Unknown. This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways.

Gene References into Functions

In Gprc5b(-/-) mice, long-term motor learning was impaired in both the rotarod test and the horizontal optokinetic response eye movement (HOKR) test PMID:29481883
The G protein-coupled receptor GPRC5B contributes to neurogenesis in the developing mouse neocortex. PMID:24089469
GPRC5B activates obesity-associated inflammatory signaling in adipocytes. PMID:23169819
GPRC5B has important roles for animal behavior controlled by the central nervous system. PMID:21840300
Gprc5b-v2 may play a role during brain maturation and in matured brain, possibly through the regulation of neuronal morphology and protein-protein interaction PMID:20436672
GPRC5B is involved in retinoic acid -dependent morphogenesis/angiogenesis and regulation of extracellular matrix synthesis in the murine placenta and yolk sac. PMID:17652913