Recombinant Mouse Claudin-18 (Cldn18)

Code: CSB-CF005498MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4470

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Cldn18

Uniprot NO.

P56857

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-264

Target Protein Sequence

MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN KKIYDGGARTEDDEQSHPTKYDYV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Gene References into Functions

The presented data substantiate the hypothesis that claudin-18 is a central barrier-forming component of tight junctions and show that IL-13 downregulates claudin-18. These data also suggest that the loss of claudin-18 is associated with increased sensitization to aeroantigens and airway responsiveness PMID:27215490
The claudin-18 knockout mice exhibited decreased P2X7 mRNA transcript abundance as measured by mRNA expression microarray PMID:27663455
CLDN18 deficiency results in epithelial barrier dysfunction, injury, and impaired alveolarization in mice. PMID:24787463
Identify a role for claudin 18 in alveolar fluid homeostasis beyond its direct contributions to barrier properties. PMID:24588076
we conclude that the estrogen effects on osteoclasts may in part be mediated via regulation of Cldn-18 signaling PMID:23299504
Claudin-18 is expressed at the variety of epithelial tissues in inner ear including Organ of Corti, stria vascularis, Reissner's membrane, spiral limbus, vestibular sensory epithelia, and dark cell area. PMID:14698084
Cldn-18 is a novel negative regulator of bone resorption and osteoclast differentiation PMID:22437732
Claudin-18 forms a paracellular barrier against H(+) in the stomach. Deficiency causes paracellular H(+) leak, up-regulation of proinflammatory cytokines, recruitment of neutrophils, and atrophic gastritis. PMID:22079592
Increased expression of claudin-18 is associated with ulcerative colitis. PMID:18831034