Recombinant Mouse Claudin-18 (Cldn18)

CSB-CF005498MO
Size:
20μg
20μg100μg
US$4470
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
Cldn18
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-264
Target Protein Sequence
MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN KKIYDGGARTEDDEQSHPTKYDYV
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
Gene References into Functions
  1. The presented data substantiate the hypothesis that claudin-18 is a central barrier-forming component of tight junctions and show that IL-13 downregulates claudin-18. These data also suggest that the loss of claudin-18 is associated with increased sensitization to aeroantigens and airway responsiveness PMID:27215490
  2. The claudin-18 knockout mice exhibited decreased P2X7 mRNA transcript abundance as measured by mRNA expression microarray PMID:27663455
  3. CLDN18 deficiency results in epithelial barrier dysfunction, injury, and impaired alveolarization in mice. PMID:24787463
  4. Identify a role for claudin 18 in alveolar fluid homeostasis beyond its direct contributions to barrier properties. PMID:24588076
  5. we conclude that the estrogen effects on osteoclasts may in part be mediated via regulation of Cldn-18 signaling PMID:23299504
  6. Claudin-18 is expressed at the variety of epithelial tissues in inner ear including Organ of Corti, stria vascularis, Reissner's membrane, spiral limbus, vestibular sensory epithelia, and dark cell area. PMID:14698084
  7. Cldn-18 is a novel negative regulator of bone resorption and osteoclast differentiation PMID:22437732
  8. Claudin-18 forms a paracellular barrier against H(+) in the stomach. Deficiency causes paracellular H(+) leak, up-regulation of proinflammatory cytokines, recruitment of neutrophils, and atrophic gastritis. PMID:22079592
  9. Increased expression of claudin-18 is associated with ulcerative colitis. PMID:18831034

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.
Protein Families
Claudin family
Tissue Specificity
Isoform A1.1: Expressed in lung. Isoform A1.2: Expressed in lung. Isoform A2.1: Expressed in stomach. Isoform A2.2: Expressed in stomach.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products