MDFQGSVPTYSYDIDYGMSAPCQKINVKQIAAQLLPPLYSLVFIFGFVGNMMVFLILISCKKLKSVTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKVRTVNFGVITSVVTWAVAVFASLPEIIFTRSQKEGFHYTCSPHFPHTQYHFWKSFQTLKMVILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLLLTTFQEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.
Gene References into Functions
Data provides evidence that CCR5 has an essential role in bone-destructive conditions through the functional regulation of osteoclasts.PMID:29263385
Blockade of CCR5-mediated myeloid derived suppressor cell accumulation enhances anti-PD1 efficacy in gastric cancerPMID:29303012
the interaction between CCR5 and its ligands promotes the proliferation of CCR5(+) polymorphonuclear-myeloid-derived suppressor cells at the bone marrowPMID:29166611
This study suggested a potential neuroprotection in the absence of CCR5 receptor during global brain ischemia and reperfusion injury.PMID:28294064
Studied the effects of CCL5-CCR5 interactions in breast cancer metabolism, and findings suggest that CCL5-CCR5 interactions in the tumor microenvironment modulate metabolic events during tumor onset to promote tumorigenesis.PMID:29216863
Loss of CCR5 is associated with astrogliosis, amyloid-beta deposit and impaired memory function.PMID:26910914
These findings suggest that CCR5 is likely participating in demyelination in the spinal cord in experimental autoimmune encephalomyelitisPMID:26985768
These results demonstrate that CCR5 plays an important role in neuroplasticity, learning and memory, and indicate that CCR5 has a role in the cognitive deficits caused by HIV.PMID:27996938
The Ccr5 is crucial in directing T cells toward the Langat virus -infected brain, as well as in suppressing neutrophil-mediated inflammation within the Central Nervous System.PMID:27183602
This study showed that CCR5 ablation exacerbated Japanese encephalitis without altering viral burden in the extraneural and CNS tissues, as manifested by increased CNS infiltration of Ly-6C(hi) monocytes and Ly-6G(hi) granulocytes.PMID:27439902
this review discusses the role of CCR5 in recruitment and activation of myeloid-derived suppressor cells in melanomaPMID:28382399
These results suggested that CCR5 signaling is involved in embryo loss in Toxoplasma gondii infection during early pregnancy and that apoptosis is associated with embryo loss rather than direct damage to the fetoplacental tissues.PMID:28630065
The upregulation of CCR5 on the surface of the CD8(+) T cells increases the number of contacts with Ag-bearing dendritic cells, which ultimately results in increased CD8(+) T cell response to Ag rechallenge.PMID:26994221
CCL4-CCR5 axis can contribute to breast cancer metastasis to bone by mediating the interaction between cancer cells and fibroblasts in bone cavity.PMID:27177471
Cytokine-induced killer cells interact with tumor lysate-pulsed dendritic cells via CCR5 signaling.PMID:27216980
this study shows that diosgenin-mediated anti-allergic effects are associated with increased number of Foxp3+ Treg cells expressing CCR5PMID:27886644
CCR5 deficiency increased the production of TNF-alpha following LPS treatment through increased activation of the p38 pathway in the kidney, resulting in renal apoptosis and leukocyte infiltration and led to exacerbation of LPS-induced acute kidney injury.PMID:26055553
In West Nile virus infection of the central nervous system, CCR5 activity is required to limit viral burden in the cerebral cortex.PMID:26667390
Data show that the activation of mammalian target of rapamycin complex mTORC1 during encephalomyocarditis virus infection is chemokine (C-C) receptor 5-dependent and promotes the translation of inducible NO synthase (iNOS) and cyclooxygenase (COX)-2.PMID:26408666
CCL5-induced endothelial progenitor cell migration was increased by overexpression of CCR5 and that increase was abolished by addition of CCL5 antibody, suggesting CCL5/CCR5 interaction is involved in chemotactic effects of endothelial progenitor cells.PMID:25889019
These findings show that migration and activation of immune cells via CCR5 is required for controlling N. caninum parasites during the early phase of the infection.PMID:25558986
our results suggest that the detrimental effects of C5a in this model are partly mediated through CCR5 activation downstream of C5aR1, which may be evaluated for potential therapeutic exploitation in ALI/ARDS.PMID:25999468
CCR5 blockade promotes M2 macrophage activation and improves locomotor activity after spinal cord injury in mice.PMID:25212047
CCR5 KO mice show less cartilage degeneration but no change in bone or synovial response to medial meniscal destabilization.PMID:25498590
Results indicate that CCR5 deficiency modifies the nigrostriatal dopaminergic neuronal system and bidirectional interaction between neurons and glial cells via CCR5 might be important for dopaminergic neuronal survivalPMID:22922220
These data bring new insights on the association between viral infections and the chemokine receptor CCR5.PMID:25939314
CCR5 is essential to the control of T. gondii infection and to maintain the metabolic, hepatic and intestinal integrity.PMID:25119429
Mycobacterium infection significantly increased CCR5 expression in macrophages there by facilitating the activation of its downstream signaling. These events culminated in up-regulation of the immunosuppressive cytokine IL-10 productionPMID:24695099
These results reveal novel alloreactive CD8 T cell specificities in CCR5-deficient recipients of single class II MHC renal allografts that mediate rejection of the allografts.PMID:25172484
This study provides evidence for an indirect pathologic role of CCR5 and a novel protective effect of LCN2 in combination with inhibition of CCR5 in HIV-associated brain injury.PMID:25031461
mediates neutrophil recruitment in acute lung injuryPMID:23860188
CCL3-CCR5-mediated fibroblast accumulation may be required, in addition to leukocyte infiltration, to induce full-blown colitis-associated carcinogenesis.PMID:24510316
this study for the first time demonstrates the importance of TLR2/CCR5 crosstalk as a significant determinant of Leishmania donovani entry in host macrophages.PMID:24617012
Inflammation-induced hepatocellular carcinoma is dependent on CCR5 in mice.PMID:23526353
absence of CCR5 delays the resolution of inflammatory responses triggered by single-walled carbon nanotubesPMID:22438032
The CCR5/MIP-1alpha axis may contribute to migration of infected cells to the brain and consequently affect the pathogenesis during Rocio virus infection.PMID:24080631
These findings suggest that whereas CCR5 plays a minor role in regulating immune cell infiltration and inflammation in metabolic tissues, deficiency of CCR5 impairs systemic glucose tolerance as well as adipose tissue and muscle insulin signaling.PMID:23941876
Pain responses of CCR5 knockout mice to chemical or inflammation stimuli are milder than those of CCR5 wild-type mice.PMID:23147416
These results suggest that the absence of CCR5 may boost the immune response with a high neutrophil recruitment which most likely helps in viral clearance.PMID:23391218
ata indicate an expansion of CXCR3(+) and CCR5(+) T cells was observed in the tumor.PMID:23326300
the critical mechanism underlying enhanced effect of CCR5-transducedneural stem cells on experimental autoimmune encephalomyelitis is the early migration of chemokine receptor-transduced NSCs into the inflamed foci.PMID:22526024
CCR5 deficiency suppressed lung tumor development through the inhibition of nuclear factor-kappaB/STAT3 pathways and the downregulation of MCP-1 in the carcinogen-induced lung tumor model.PMID:22907530
the immune responses against JEV in mice lacking expression of the chemokine receptor CCR5PMID:23028638
identification of the human immunodeficiency virus (HIV) co-receptor CCR5 as a cellular determinant required for cytotoxic targeting of subsets of myeloid cells and T lymphocytes by the S. aureus leukotoxin ED (LukED)PMID:23235831
These results suggest that MIP-1beta is a novel key mediator, and the peripheral MIP-1beta-CCR5 axis contributes to neuropathic pain.PMID:22528550
leukostasis in early diabetic retinopathy involves activated CCR5(+)CD11b(+) myeloid cells (presumed monocytes).PMID:22677420
analysis of transmembrane protein aptamers that inhibit CCR5 expression and HIV coreceptor functionPMID:22811524
Potent in vivo suppression ability of CD103-positive regulatory T cells (Treg) is not due to stronger suppression ability per cell but due to their tissue migration ability through CCR5 expression.PMID:22664873
The results showed that CCR5 deficiency caused apoptotic cell death of melanoma through inhibition of NF-kappaB and upregulation of IL-1Ra.PMID:22567084
It was shown that CCR5 plays a critical role in adipose tissue macrophage recruitment and polarization and subsequent development of insulin resistance.PMID:22474027