Recombinant Mouse C-C chemokine receptor type 5 (Ccr5), partial

Code: CSB-EP004844MO
Size:
20ug
20ug100ug1mg
US$256
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: N-terminal 6xHis-B2M-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Mouse Ccr5 protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Ccr5
Uniprot NO.
Research Area
Immunology
Alternative Names
C-C CKR-5; CC-CKR-5; CCR-5;MIP-1 alpha receptor
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
263-354aa
Target Protein Sequence
QEFFGLNNCSSSNRLDQAMQATETLGMTHCCLNPVIYAFVGEKFRSYLSVFFRKHMVKRFCKRCSIFQQDNPDRASSVYTRSTGEHEVSTGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-B2M-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for a number of inflammatory CC-chemokines including CCL3/MIP-1-alpha, CCL4/MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation. Participates in T-lymphocyte migration to the infection site by acting as a chemotactic receptor.
Gene References into Functions
  1. Data provides evidence that CCR5 has an essential role in bone-destructive conditions through the functional regulation of osteoclasts. PMID:29263385
  2. Blockade of CCR5-mediated myeloid derived suppressor cell accumulation enhances anti-PD1 efficacy in gastric cancer PMID:29303012
  3. the interaction between CCR5 and its ligands promotes the proliferation of CCR5(+) polymorphonuclear-myeloid-derived suppressor cells at the bone marrow PMID:29166611
  4. This study suggested a potential neuroprotection in the absence of CCR5 receptor during global brain ischemia and reperfusion injury. PMID:28294064
  5. Studied the effects of CCL5-CCR5 interactions in breast cancer metabolism, and findings suggest that CCL5-CCR5 interactions in the tumor microenvironment modulate metabolic events during tumor onset to promote tumorigenesis. PMID:29216863
  6. Loss of CCR5 is associated with astrogliosis, amyloid-beta deposit and impaired memory function. PMID:26910914
  7. These findings suggest that CCR5 is likely participating in demyelination in the spinal cord in experimental autoimmune encephalomyelitis PMID:26985768
  8. These results demonstrate that CCR5 plays an important role in neuroplasticity, learning and memory, and indicate that CCR5 has a role in the cognitive deficits caused by HIV. PMID:27996938
  9. The Ccr5 is crucial in directing T cells toward the Langat virus -infected brain, as well as in suppressing neutrophil-mediated inflammation within the Central Nervous System. PMID:27183602
  10. This study showed that CCR5 ablation exacerbated Japanese encephalitis without altering viral burden in the extraneural and CNS tissues, as manifested by increased CNS infiltration of Ly-6C(hi) monocytes and Ly-6G(hi) granulocytes. PMID:27439902
  11. this review discusses the role of CCR5 in recruitment and activation of myeloid-derived suppressor cells in melanoma PMID:28382399
  12. These results suggested that CCR5 signaling is involved in embryo loss in Toxoplasma gondii infection during early pregnancy and that apoptosis is associated with embryo loss rather than direct damage to the fetoplacental tissues. PMID:28630065
  13. The upregulation of CCR5 on the surface of the CD8(+) T cells increases the number of contacts with Ag-bearing dendritic cells, which ultimately results in increased CD8(+) T cell response to Ag rechallenge. PMID:26994221
  14. CCL4-CCR5 axis can contribute to breast cancer metastasis to bone by mediating the interaction between cancer cells and fibroblasts in bone cavity. PMID:27177471
  15. Cytokine-induced killer cells interact with tumor lysate-pulsed dendritic cells via CCR5 signaling. PMID:27216980
  16. this study shows that diosgenin-mediated anti-allergic effects are associated with increased number of Foxp3+ Treg cells expressing CCR5 PMID:27886644
  17. CCR5 deficiency increased the production of TNF-alpha following LPS treatment through increased activation of the p38 pathway in the kidney, resulting in renal apoptosis and leukocyte infiltration and led to exacerbation of LPS-induced acute kidney injury. PMID:26055553
  18. In West Nile virus infection of the central nervous system, CCR5 activity is required to limit viral burden in the cerebral cortex. PMID:26667390
  19. Data show that the activation of mammalian target of rapamycin complex mTORC1 during encephalomyocarditis virus infection is chemokine (C-C) receptor 5-dependent and promotes the translation of inducible NO synthase (iNOS) and cyclooxygenase (COX)-2. PMID:26408666
  20. CCL5-induced endothelial progenitor cell migration was increased by overexpression of CCR5 and that increase was abolished by addition of CCL5 antibody, suggesting CCL5/CCR5 interaction is involved in chemotactic effects of endothelial progenitor cells. PMID:25889019
  21. These findings show that migration and activation of immune cells via CCR5 is required for controlling N. caninum parasites during the early phase of the infection. PMID:25558986
  22. our results suggest that the detrimental effects of C5a in this model are partly mediated through CCR5 activation downstream of C5aR1, which may be evaluated for potential therapeutic exploitation in ALI/ARDS. PMID:25999468
  23. CCR5 blockade promotes M2 macrophage activation and improves locomotor activity after spinal cord injury in mice. PMID:25212047
  24. CCR5 KO mice show less cartilage degeneration but no change in bone or synovial response to medial meniscal destabilization. PMID:25498590
  25. Results indicate that CCR5 deficiency modifies the nigrostriatal dopaminergic neuronal system and bidirectional interaction between neurons and glial cells via CCR5 might be important for dopaminergic neuronal survival PMID:22922220
  26. These data bring new insights on the association between viral infections and the chemokine receptor CCR5. PMID:25939314
  27. CCR5 is essential to the control of T. gondii infection and to maintain the metabolic, hepatic and intestinal integrity. PMID:25119429
  28. Mycobacterium infection significantly increased CCR5 expression in macrophages there by facilitating the activation of its downstream signaling. These events culminated in up-regulation of the immunosuppressive cytokine IL-10 production PMID:24695099
  29. These results reveal novel alloreactive CD8 T cell specificities in CCR5-deficient recipients of single class II MHC renal allografts that mediate rejection of the allografts. PMID:25172484
  30. This study provides evidence for an indirect pathologic role of CCR5 and a novel protective effect of LCN2 in combination with inhibition of CCR5 in HIV-associated brain injury. PMID:25031461
  31. mediates neutrophil recruitment in acute lung injury PMID:23860188
  32. CCL3-CCR5-mediated fibroblast accumulation may be required, in addition to leukocyte infiltration, to induce full-blown colitis-associated carcinogenesis. PMID:24510316
  33. this study for the first time demonstrates the importance of TLR2/CCR5 crosstalk as a significant determinant of Leishmania donovani entry in host macrophages. PMID:24617012
  34. Inflammation-induced hepatocellular carcinoma is dependent on CCR5 in mice. PMID:23526353
  35. absence of CCR5 delays the resolution of inflammatory responses triggered by single-walled carbon nanotubes PMID:22438032
  36. The CCR5/MIP-1alpha axis may contribute to migration of infected cells to the brain and consequently affect the pathogenesis during Rocio virus infection. PMID:24080631
  37. These findings suggest that whereas CCR5 plays a minor role in regulating immune cell infiltration and inflammation in metabolic tissues, deficiency of CCR5 impairs systemic glucose tolerance as well as adipose tissue and muscle insulin signaling. PMID:23941876
  38. Pain responses of CCR5 knockout mice to chemical or inflammation stimuli are milder than those of CCR5 wild-type mice. PMID:23147416
  39. These results suggest that the absence of CCR5 may boost the immune response with a high neutrophil recruitment which most likely helps in viral clearance. PMID:23391218
  40. ata indicate an expansion of CXCR3(+) and CCR5(+) T cells was observed in the tumor. PMID:23326300
  41. the critical mechanism underlying enhanced effect of CCR5-transducedneural stem cells on experimental autoimmune encephalomyelitis is the early migration of chemokine receptor-transduced NSCs into the inflamed foci. PMID:22526024
  42. CCR5 deficiency suppressed lung tumor development through the inhibition of nuclear factor-kappaB/STAT3 pathways and the downregulation of MCP-1 in the carcinogen-induced lung tumor model. PMID:22907530
  43. the immune responses against JEV in mice lacking expression of the chemokine receptor CCR5 PMID:23028638
  44. identification of the human immunodeficiency virus (HIV) co-receptor CCR5 as a cellular determinant required for cytotoxic targeting of subsets of myeloid cells and T lymphocytes by the S. aureus leukotoxin ED (LukED) PMID:23235831
  45. These results suggest that MIP-1beta is a novel key mediator, and the peripheral MIP-1beta-CCR5 axis contributes to neuropathic pain. PMID:22528550
  46. leukostasis in early diabetic retinopathy involves activated CCR5(+)CD11b(+) myeloid cells (presumed monocytes). PMID:22677420
  47. analysis of transmembrane protein aptamers that inhibit CCR5 expression and HIV coreceptor function PMID:22811524
  48. Potent in vivo suppression ability of CD103-positive regulatory T cells (Treg) is not due to stronger suppression ability per cell but due to their tissue migration ability through CCR5 expression. PMID:22664873
  49. The results showed that CCR5 deficiency caused apoptotic cell death of melanoma through inhibition of NF-kappaB and upregulation of IL-1Ra. PMID:22567084
  50. It was shown that CCR5 plays a critical role in adipose tissue macrophage recruitment and polarization and subsequent development of insulin resistance. PMID:22474027

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products