Recombinant Lactococcus lactis subsp. lactis Lipoprotein signal peptidase (lspA)

Code: CSB-CF875000LNG
Size:
20μg
20μg100μg
US$3617
Quantity:
Express system: in vitro E.coli expression system
Species: Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
lspA
Uniprot NO.
Species
Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Source
in vitro E.coli expression system
Expression Region
1-150
Target Protein Sequence
MKKLLSLVIIVVGIVADQIFKNWIVANIQLGDTEKIWPNVLSLTYIKNDGAAWSSFSGQQ WFFLILTPIVLVVALWFLWKKMAQNWYFIGLTLIIAGALGNFIDRIRQGFVVDMFQTEFI NFPIFNIADILLSVGFVLLFIAILTDKETK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Peptidase A8 family
Database Links

KEGG: lla:L0335

STRING: 272623.L0335

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products