All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule

Recombinant Human coronavirus NL63 Non-structural protein 3 (3)

Code: CSB-CF754294HIX
Size:
20μg
20μg100μg
US$4178
Quantity:
Express system: in vitro E.coli expression system
Species: Human coronavirus NL63 (HCoV-NL63)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
3
Uniprot NO.
Q6Q1S1
Species
Human coronavirus NL63 (HCoV-NL63)
Source
in vitro E.coli expression system
Expression Region
1-225
Target Protein Sequence
MPFGGLFQLTLESTINKSVANLKLPPHDVTVLRDNLKPVTTLSTITAYLLVSLFVTYFAL FKPLTARGRVACFVLKLLTLFVYVPLLVLFGMYLDSFIIFSTLLFRFIHVGYYAYLYKNF SFVLFNVTKLCFVSGKCWYLEQSFYENRFAAIYGGDHYVVLGGETITFVSFDDLYVAIRG SCEKNLQLMRKVDLYNGAVIYIFAEEPVVGIVYSSQLYEDVPSIN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Protein FAQs
Datasheet & COA
Please contact us to get it.
Description

To produce recombinant HCoV-NL63 Non-structural protein 3 protein, a well-established recombinant DNA technology is the key. A DNA template of Non-structural protein 3 was constructed with N-terminal 10xHis tag using the technique. Once the template was made, the recombinant HCoV-NL63 Non-structural protein 3 protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 1-225aa of the HCoV-NL63 Non-structural protein 3.

Human coronavirus NL63 non-structural protein 3 (Nsp3) is a viral protease involved in viral protein biogenesis, replication/transcription complex (RTC) formation, and regulation of host ubiquitinylation and ISGylation. Nsp3 exerts multiple roles in the viral life cycle. It can functions as a scaffold protein by interacting with itself and other proteins including viral Nsps and host proteins.

Related Products

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Gene References into Functions
  1. The authors give evidence that ORF 3 protein is a structural N-glycosylated and virion-incorporated protein. PMID:20078868

Show More

Hide All

Subcellular Location
Host membrane; Multi-pass membrane protein.
Database Links

KEGG: vg:2943500

Promotions
Reward For Reviews
Free trial size antibodies
Contact Us

  Email: support@cusabio.com
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
Another powerful addition to domestic IL-17A inhibitors! 3S Guojian's Anmoqitamab approved, with once-every-8-week dosing—a game-changer for psoriasis patients.ANGPTL3: From Mechanisms to Clinics, Exploring a Novel Therapeutic Target for Cardiometabolic DiseasesFCGR3A: A Key Receptor for Immune RegulationTargeting TNFRSF13B: Dual-Target Strategies Usher in New Focus for Treating Tumors and Autoimmune DiseasesMetabolic Hub, Reprogramming Disease: SLC3A2 – From Amino Acid Transport Mechanism to Emerging Therapeutic TargetCUSABIO Quarterly Citation Review: 800 New Product Citations in Q3, Total Citations Hit 27,500!LAG3: The Next Frontier in Tumor ImmunotherapyLYPD3: An Emerging Star in Solid Tumor TherapyB7-H6 (NCR3LG1): A Key Ligand of NK Cell Immune Checkpoints Reshaping the Landscape of Tumor ImmunotherapyImmune Battlefield's "Scout": Decoding the NCR3 TargetTNFRSF13C (BAFF-R): A Key Target for Immune Regulation and Disease TreatmentCUSABIO Monthly Citations Review: November 2024, Over 230 Citations with an Impact Factor Exceeding 1200, Totaling 24,100 Articles!CUSABIO Monthly Citations Review: October 2024, Over 240 Citations with an Impact Factor Exceeding 1200, Totaling 23,800 Articles!CUSABIO Quarterly Citations Review: Q3 2024, Over 720 Citations with an Impact Factor Exceeding 3500, Totaling 23,600 Articles!CUSABIO Monthly Citations Review: In August, 240 High-Impact Citations, 23,400 Total Articles!CUSABIO Monthly Citations Review:240 High-Impact Citations, 23,200 Total Articles!CUSABIO Quarterly Citations Review: 800 High-Impact Citations, 23000 Total Articles!CT83/KK-LC-1: a Promising Therapeutic Target of CTAs Family, Currently in Clinical Research for Breast, Lung, Gastric Cancers, and Beyond!CUSABIO April Citations Review: 300 High-Impact Citations, Cumulative Impact Factor Exceeds 1500+!Dipeptidase 3 (DPEP3): an Emerging Member of the DPEP Family, a Potential Therapeutic Target in Male Fertility or Tumor Research!DSG3: An Emerging Tumor-Associated Adhesion Factor, a Specific Marker for the Clinical Diagnosis of Pemphigus Vulgaris (PV)!ENPP3 (CD203c): An Extracellular Enzyme, a Regulator for Nucleotide and Energy, an Indicator for Allergies, an Effective Target for RCC Therapy!Exhibition Preview | CUSABIO Invites You to Meet at PEGS Boston 2023Great News! CUSABIO's Quarterly Citation: 455 Papers, 2356.7842 Impact Factor!CLDN3: Another Tight Junction Protein or New Drug Target, Interest in CLDN Family is Growing Fast!PROM1 (CD133): A New Cell Surface Marker of Cancer Stem Cells (CSCs), A More Significant Target for Immunotherapy!SLC39A6/ZIP6: a Key Member of Zinc Transporters, a Novel Targeting Antigen of ADC!CD93, A Rising Star in Anti-Tumor TherapyStreamlining Antibody Internalization Assessment with DT3C: Accelerating ADC Candidate SelectionDLL3: A New Molecular Target in CancerGPC3: The Next-Promising Target in Cancer ImmunotherapyERBB3/HER3: a New Target for Tumor Therapy, a Driver Gene of Multi-TumorsSTAT3: a Key Transcriptional Regulator in CancerThe Multifunctional Enzyme CD38: A Target for Immunotherapeutic Approaches in CancerCD73 (NT5E), What a Powerful Therapy Target in Tumor Immune63.9% Objective Response Rate! B7-H3 (CD276) Targeted Therapy Transforms Small Cell Lung Cancer Treatment, Domestic Players Compete in Hundred-Billion-Yuan MarketEphA3-A (EPHA3) Regulator of Cell Adhesion and MigrationCD31 (PECAM1)- A Complex Function MoleculeThe True Face of Tumor Suppressor Gene TP53PI3K-Akt Signaling Pathway and CancerNa<sub>2</sub>CO<sub>3</sub> - NaHCO<sub>3</sub> BufferUpcoming Event: AACC, 27-31 July 2014CUSABIO's Five Expression SystemsHow to express a protein with bioactivity?How to choose a suitable expression vector?How to Choose the Right Recombinant Protein for Your Experimental Model?How to Properly Reconstitute Lyophilized Proteins?Verified vs. Unverified Recombinant Proteins: Making the Right Choice for Your ResearchApproaches to Determinate Protein ConcentrationExploring Protein-Protein Interactions: A Comprehensive Guide to Understanding and Utilizing ItWhat Is Protein Characterization: Definition, Examples, Methods, and TechniquesProtein Tags: A Comprehensive Overview
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of email
Email
support@cusabio.com
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Privacy Policy
▲ Select 0 Products