Recombinant Human Vomeronasal type-1 receptor 1 (VN1R1)

Code: CSB-CF861973HU
Size:
20μg
20μg100μg
US$5136
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
VN1R1
Uniprot NO.
Alternative Names
VN1R1; V1RL1; VNR19I1; Vomeronasal type-1 receptor 1; G-protein coupled receptor GPCR24; hGPCR24; V1r-like receptor 1; V3r-related gene protein; Vomeronasal olfactory receptor chromosome 19 subtype I member 1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-353
Target Protein Sequence
MVGDTLKLLSPLMTRYFFLLFYSTDSSDLNENQHPLDFDEMAFGKVKSGISFLIQTGVGI LGNSFLLCFYNLILFTGHKLRPTDLILSQLALANSMVLFFKGIPQTMAAFGLKYLLNDTG CKFVFYYHRVGTRVSLSTICLLNGFQAIKLNPSICRWMEIKIRSPRFIDFCCLLCWAPHV LMNASVLLLVNGPLNSKNSSAKNNYGYCSYKASKRFSSLHAVLYFSPDFMSLGFMVWASG SMVFFLYRHKQQVQHNHSNRLSCRPSQEARATHTIMVLVSSFFVFYSVHSFLTIWTTVVA NPGQWIVTNSVLVASCFPARSPFVLIMSDTHISQFCFACRTRKTLFPNLVVMP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Putative pheromone receptor.
Gene References into Functions
  1. the reported association in this study suggests that, as a result of genetic variation, naturally occurring endogenous modulation of VN1R1 function affects women's socio-sexual behavior, and that humans thus communicate via chemo-signaling. PMID:28440809
  2. Structure and function analyses of the purified GPCR human vomeronasal type 1 receptor 1 PMID:22355687
  3. The human VN1R1 gene are unlikely to be associated with gender and hence to contribute to distinct gender-specific behavior. PMID:17627382

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the olfactory mucosa, very low expression in brain, lung and kidney.
Database Links

HGNC: 13548

UNIGENE: Hs.677423

KEGG: hsa:57191

STRING: 9606.ENSP00000322339

OMIM: 605234

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products