FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKLHLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF-kappa-B.
Gene References into Functions
Data suggest that CD4+ T cell-associated HIV-1 RNA is often highly enriched in cells expressing CD30; cells expressing this marker considerably contribute to total pool of transcriptionally active CD4+ lymphocytes in individuals on suppressive anti-retroviral drug therapy; CD30 may be a marker of residual, transcriptionally active HIV-1 infected cells in blood and in gut-associated lymphoid tissue.PMID:29470552
The stable elevation in classical Hodgkin lymphoma risk with elevated levels of sCD30 and IL6 across 4 or more years prior to diagnosis may also reflect a B-cell-stimulatory environment that promotes the genesis of these cancers.PMID:28341757
extranodal NK/T-cell lymphoma, nasal type(ENKTL) is the most common type of mature T-cell and NK-cell lymphoma diagnosed at our institution. CD30 is frequently expressed in ENKTL and represents a therapeutic target; however, it may not be a prognostic marker.PMID:28486951
This study suggests that in patients with CD30+ lymphoproliferative disorders, an aggressive clinical course cannot be defined by the presence of TP63 rearrangements, as was recently shown in systemic ALK negative anaplastic large cell lymphoma.PMID:27146432
Data suggest that Brentuximab Vedotin (SGN-35) damaged CD30 ligand (CD30L)-immune cells through CD30 extracellular vesicles (EVs).PMID:27105521
median FoxP3+ Treg count was higher in CD30+ than in CD30- posttransplant lymphoproliferative disorders, 3.0 vs 0PMID:29126177
Variant histology is common in pediatric NLPHL, especially types C and E, which are associated with IgD expression. Type C variant histology and possibly type D are associated with decreased EFS, but neither IgD nor CD30 are adverse features. Variant histology may warrant increased surveillance, but did not affect overall survival.PMID:28802087
Expression of CD30 in patients with both DLBCL and other aggressive B-cell lymphomas and the absence of MYC oncogene-driven proliferation in the majority of these tumors suggests that brentuximab may be a particularly effective form of targeted therapy in the subset of patients with high CD30 expression.PMID:27521276
Prevalence of the CD30 (Ki-1) antigen in human solid tumors was summarized.PMID:28427526
Higher serum sCD30 levels were associated with an increased risk of bacterial infection after kidney transplantation.PMID:28122147
CD30 expression was detected in up to 25% of cases of diffuse large B-cell lymphoma and was more frequent in tumors without MYC rearrangement. CD30 expression was not associated with overall survival in R-EPOCH-treated de novo DLBCL patients.PMID:27816715
CD30 facilitates phosphorylation of heat shock factor 1, activates heat shock promoter element, and induces heat shock protein (HSP) 90.PMID:27870927
this study shows that polyclonal and allogeneic stimulation induced higher levels of CD30 transcripts in end-stage renal disease patients compared to control patientsPMID:26970513
CD30 expression was not associated with prognosis in our cohort of de novoDLBCL, including in patients who received aggressive chemotherapy. CD30 expression and MYC rearrangement were mutually exclusive in de novoDLBCL.PMID:26340843
Case Report: CD30 positive lymphomatoid papulosis arising in association with cutaneous amyloidosis in a patient with multiple myeloma.PMID:26981738
The heterogeneity of CD30 expression in refractory or relapsed peripheral T-cell lymphoma patients indicates the likelihood for better response for patients with strong CD30 expression by tumor cells.PMID:26703966
CD30 may be useful as a prognostic marker in rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone (R-CHOP) treated DLBCLs, indicating favorable outcomes in a Chinese population.PMID:26884853
this review is focused on the role of CD30 receptor and p53 as novel targets for therapy in ALK+ ALCL, and also provides an update on their potential involvement in ALK+ ALCL pathogenesisPMID:26709646
Most angioimmunoblastic T-cell lymphoma and peripheral T-cell lymphoma-not otherwise specified express variable levels of CD30.PMID:26574847
Upregulated expression of CD30 is commonly found in sclerosing angiomatoid nodular transformation of the spleen.PMID:26261484
Our results demonstrated significantly elevated sCD30 levels in AS patients compared to healthy controls (HCs) with mean values of 32.0 +/- 12.2 and 24.9 +/- 8.0 ng/mL, (P(**) = 0.007), suggesting a p role of sCD30 in the pathogenesis of AS.PMID:26273636
With the introduction of the immunoconjugate brentuximab vedotin, the CD30 antigen has become an effectively targetable molecule. Therefore, we investigated the frequency and level of CD30 expression in post-transplant lymphoproliferative disorders.PMID:25248878
Data susggest that CD30 antigen may be useful as a prognostic factor and therapeutic target in extranodal natural killer/T-cell lymphoma (NKTCL).PMID:25288491
Data indicate that CD30 antigen downregulation and P-Glycoprotein (MDR1) upregulation are associated with drug resistance to brentuximab vedotin.PMID:25840583
Intralymphatic variant of ALCL and LyP may be explained, at least in part, by a particular lymphotropism of the neoplastic cells of cutaneous CD30 lymphoproliferative disorders.PMID:26371781
BAG-3 expression correlated with increased HSP70 expression in a subset of systemic T cell lymphoma cases co-expressing the CD30 antigen.PMID:24492285
These results show that high sCD30 levels are independent predictors of graft dysfunctionPMID:25698648
Single threonine residue at position 61 in CD30v that is critical for TRAF2 interaction, NFkappaB activation, and downstream CD30-NFkappaB-dependent phenotypes in hESCs was identified.PMID:25568342
Case Report: describe a CD30+ lymphoproliferative rash exhibiting a predilection for recurrence on the same skin sites.PMID:24733405
case Report: primary cutaneous CD30+ anaplastic large cell lymphoma treated successfully with brentuximab vedotin.PMID:24733422
Elevated serum sCD30 is associated with increased risk of non-Hodgkin lymphoma.PMID:25567136
Case Report: suggest Sezary syndrome, CD30 anaplastic large-cell lymphoma, and mycosis fungioides are interrelated.PMID:25548993
levels of serum sCD30 tend to be higher in individuals with atopy. Improvement in lung function seems to be associated with a decrease in sCD30 in children with atopy and troublesome lung symptoms.PMID:25492095
occurs in a significant subset of angiosarcomas and epithelioid hemangioendotheliomasPMID:24805132
findings uncover the oncogenic role of the JUNB/CD30 axis and its potential as therapeutic target in ALK+ ALCL.PMID:25145835
Data indicate a chimeric fusion involving nucleophosmin NPM1 (5q35) and TYK2 kinase (19p13) that encodes an NPM1-TYK2 protein in cutaneous CD30 antigen-positve lymphoproliferative disorders.PMID:25349176
is expressed in a substantial proportion of DLBCL and CD30 immunohistochemistry may be a useful prognostic marker in R-CHOP treated GCB-DLBCL.PMID:25135752
The expression of CD30 by mastocytosis mast cells may influence the clinical phenotype and management of mastocytosis. (Review)PMID:24745678
a substantial subset of patients with T-ALL have lymphoblasts that express surface CD30. CD30 expression by T-lymphoblasts also appears to be up-regulated in patients who are treated with high-dose chemotherapy.PMID:23937105
Suggest intralymphatic cutaneous anaplastic large cell lymphoma/lymphomatoid papulosis are part of an expanding spectrum of CD30-positive lymphoproliferative disorders.PMID:24805854
higher serum levels in Ewing sarcoma patients with primary bone tumorsPMID:24375064
diagnostic and prognostic value of CD30 expression in systemic mastocytosis as assessed by multiparameter flow cytometryPMID:24111625
this study highlights a novel SATB1-p21 axis that plays an important role in the disease progression of cutaneous CD30+LPDs, which provides novel molecular insights into this disease and possibly leads to new therapies in the future.PMID:24747435
serum concentration during pregnancy is not associated with pre-eclampsia and recurrent pregnancy lossPMID:23268289
CD30 expression on lymphomatous cells makes an attractive target for drug-conjugated antibody-directed therapies.PMID:23716537
CD30(+) peripheral T-cell lmyphomas differed significantly from CD30(-) samples.PMID:23716562
Post-transplant sCD30 serum levels, especially in conjunction with information regarding HLA class II antibodies and serum creatinine levels, provide valuable information regarding graft outcomePMID:23928467
Malignant Hodgkin and Reed-Sternberg cells release CD30 on the surface of extracellular vesicles facilitating CD30-CD30L interaction between cell types.PMID:24659185
High pretransplant levels of serum soluble CD30 can be a risk factor for kidney transplant rejection, and its high negative predictive value at various cutoffs make it useful to find candidates with a low risk of acute rejection after transplant.PMID:23477385
Soluble CD30 levels are significantly reduced in combination immunosuppression but are differentially affected by different immunosuppressant agents.PMID:23503451
Show
More
Hide
All
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm.
Tissue Specificity
[Isoform 2]: Detected in alveolar macrophages (at protein level).