Abbreviation
Recombinant Human TNFRSF8 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L(CSB-MP023996HU1c9), the EC50 is 14.96-20.25 ng/ml.
Alternative Names
TNFRSF8; CD30; D1S166E; Tumor necrosis factor receptor superfamily member 8; CD30L receptor; Ki-1 antigen; Lymphocyte activation antigen CD30; CD antigen CD30
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-379aa
Target Protein Sequence
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5 μg/ml can bind human CD30L(CSB-MP023996HU1c9), the EC50 is 14.96-20.25 ng/ml.
Description
CD30 (TNFRSF8) serves as a critical costimulatory receptor in Hodgkin lymphoma biology and T-cell activation, making precise characterization of its ligand interactions essential for oncology-focused drug discovery. This recombinant human CD30 ectodomain, spanning residues 19–379, is produced in mammalian cells to preserve native glycosylation and disulfide-dependent folding required for authentic CD30L engagement. Functional ELISA confirms robust binding to human CD30L with an EC50 of 14.96–20.25 ng/ml, providing a validated basis for ligand-receptor interaction assays, competitive blocking antibody screening, therapeutic antibody epitope mapping, and affinity characterization by SPR or BLI. The protein carries N-terminal 10×His and C-terminal Myc tags for flexible immobilization strategies, and with purity exceeding 95% by SDS-PAGE alongside endotoxin levels below 1.0 EU/μg, it meets the quality thresholds commonly required for cell-based functional assays and sensitive binding studies in cancer research.