Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9)

CSB-CF023997HU(A4)
Size:
20μg
20μg100μg
US$4395
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: 10xHis-SUMO-tag
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
TNFSF9
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-254
Target Protein Sequence
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Protein Length
full length protein
Tag Info
10xHis-SUMO-tag
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
Gene References into Functions
  1. CD137L-dendritic cells (CD137L-DCs) express high levels of adhesion molecules, display strong attachment. PMID:27431276
  2. TNFSF9 exerts an inhibitory effect on hepatocellular carcinoma and may be a tumor suppressor. PMID:28547807
  3. 4-1BB and 4-1BBL qualify as markers for prediction of patients' course and represent a valuable screening target for patients with acute myeloid leukemia at initial diagnosis. PMID:27388616
  4. the results from this study show that the costimulatory 4-1BB ligand fortifies an antigen-rich melanoma cell line with enhanced antigen-specific stimulation of CD8 T cells PMID:27564312
  5. the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated. PMID:27430526
  6. blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation. PMID:26872462
  7. CD137L is overexpressed in non-small cell lung cancer specimens and positive expression of CD137L was associated with better overall survival. PMID:25631633
  8. In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells. PMID:26125931
  9. vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer PMID:25872647
  10. Elevated plasma levels and monocyte-associated expression of CD137 ligand in patients with acute atherothrombotic stroke PMID:24899613
  11. Hence, the targeted combination of IL-15 and 4-BBL in the form of a trifunctional antibody-fusion protein is a promising new approach for cancer immunotherapy. PMID:24198185
  12. monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline. PMID:24639347
  13. TIRAP and IRAK2 are critical for the sustained inflammatory response that is mediated by late-phase signaling by the TLR-4-1BBL complex. PMID:24084649
  14. this is the first study to indicate that this member of the TNF superfamily, CD137, is modulated by SAHA treatment in breast PMID:22797667
  15. Data show that TNFR1 associates with CD137L and is required for CD137L reverse signaling. PMID:23620528
  16. CD137L is a novel diagnostic marker of subtypes of non-Hodgkin B-cell lymphomas. PMID:23095505
  17. signaling through CD137L in non-hematopoietic cells such as epithelial cells and endothelial cells has been shown to play an essential role in sterile inflammation by regulating immune cell recruitment. [Review] PMID:22526397
  18. Stimulation of non-adherent PBMC with OVCAR-3 cells expressing 4-1BB ligand (4-1BBL) or IL-12 resulted in preferential expansion of the NK cell population. PMID:22021067
  19. Data indicate that ex4-1BBL augments 4-1BB expression not only on the primed T cell, but also on DC. PMID:21745658
  20. The expression of CD137L might play an important role in the development of laryngeal carcinomas. PMID:20422976
  21. 4-1BBL and TRAF1 in the CD8 T cell response to influenza virus and HIV PMID:21153322
  22. K562-MICA-4-1BBL-IL-15 cells would be developed for expansion of NK cells ex vivo and may have important implications for clinical immunotherapy. PMID:20670353
  23. These data point to a hitherto unrecognized role of CD137 and CD137 ligand in multiple myeloma cell biology. PMID:20520765
  24. TNFSF9 mRNA levels in peripheral blood mononuclear cells may be associated with primary biliary cirrhosis progression. PMID:20303781
  25. Cocultures of Natural killer (NK) cells with CD137L transfectants confirmed that human CD137 inhibits NK-cell reactivity, while activating signals were transduced by its counterpart on NK cells in mice. PMID:20008791
  26. the structure of the trimer of human 4-1BB ligand is unique among members of the tumor necrosis factor superfamily PMID:20032458
  27. 4-1BBL and 4-1BB may have immunomodulatory functions, as shown by the anti-leukemia activity of MS-275 histone deacetylase inhibitor PMID:19759901
  28. 4-1BBL provides a costimulatory signal for T cell activation, thereby allowing T cell expansion as well as cytokine production and the development of cytolytic effector function. PMID:11994439
  29. Stimulation of 4-1BBL on DCs with 4-1BB-Fc or with 4-1BB-transfected Jurkat cells resulted in acquisition of capacity for the immature DCs to produce IL-12, suggesting that 4-1BBL may be an important mediator for maturation of CD11c(+) myeloid DCs PMID:12590704
  30. 4-1 BB ligand can costimulate human CD28- T cells, resulting in cell division, inflammatory cytokine production, increased perforin levels, enhancement of cytolytic effector function, as well as the up-regulation of the anti-apoptotic protein Bcl-X(L). PMID:12645943
  31. First evidence of expression and synthesis of CD137 and its ligand by human brain cells. PMID:13130507
  32. Data show that reverse signaling via 4-1BB-ligand enhanced interleukin-12beta mRNA and the secretion of IL-12 p70 in various antigen-presenting cells, including monocytes. PMID:14746806
  33. 4-1BB/4-1BBL and Fas/FasL pathways play important roles in vascular injury in Takayasu's arteritis. PMID:14752253
  34. Data suggest that levels of soluble 4-1BB and 4-1BB ligand in sera at the time of diagnosis may be indicative of the severity and outcome of rheumatoid arthritis. PMID:15031666
  35. trimeric CD137L (4-1BBL) requires cross-linking for its T cell co-stimulation activity PMID:16204238
  36. Signaling through 4-1BB-L allows B cells to proliferate and the expression of its ligand, by the intra-tumoral mesh of follicular dendritic cells (FDC), could thus serve as a paracrine loop facilitating growth and survival of MCL cells PMID:16287062
  37. Significantly lower CD137 ligand is associated with colorectal cancer patients PMID:16596186
  38. Elevated plasma levels of 4-1BBL in multiple sclerosis patients may function as a self-regulatory mechanism of the 4-1BB/4-1BBL pathway involved in the disease process. PMID:16970683
  39. Here we document a function for the TNF family member 4-1BB ligand (4-1BBL) in sustaining TLR-induced TNF production PMID:17496895
  40. Reverse signalling by CD137 ligand is mediated by protein tyrosine kinases, p38 mitogen activated protein kinase (MAPK), extracellular signal-regulated kinase (ERK)1,2, MAP/ERK kinase (MEK), Phosphoinositide-3-kinase (PI3-K) and protein kinase A (PKA). PMID:17855813
  41. selective immunosuppression through MSCs may perhaps occur partly through an increase in CD137L+ on T-lymphocytes PMID:17972956
  42. T cells that had become non-responsive to anti-CD3 could be reactivated to proliferate when costimulated with 4-1BBL, either alone or combined with CD80/CD86. PMID:17977894
  43. CD80 and 4-1BBL induce auto- and transcostimulation in tumor cells PMID:18026115
  44. deliver new insights into the multiple effects of reverse signaling of CD137L in human DC during the initiation of an adaptive immune response PMID:18395851
  45. PGE(2) induced the expression of the costimulatory molecules OX40L, CD70, and 4-1BBL on human dendritic cells. PMID:19029446
  46. in cells costimulated with CD80/86 that had downregulated CD28 expression and ceased to proliferate, reactivation of proliferation by 4-1BBL costimulation also restored their CD28 expression PMID:19217084
  47. (c)4-1BBL can be expressed on mononuclear blood cells in acute myeloid leukemia, myelodysplasia or non-Hodgkin lymphoma and can be coexpressed on lymphoid or myeloid malignant cells and on dendritic cells differentiated from AML-blasts. PMID:19225975
  48. reverse signaling of 4-1BBL promotes the differentiation of potent T(h)1-inducing dendritic cells from human monocytes. PMID:19684160

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Expressed in brain, placenta, lung, skeletal muscle and kidney.
Database Links

HGNC: 11939

UNIGENE: Hs.1524

KEGG: hsa:8744

STRING: 9606.ENSP00000245817

OMIM: 606182

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products