Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial (Active)

CSB-MP023997HU1
Size:
20ug
20ug100ug1mg
US$136
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: N-terminal hFc-Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.
Promotion

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2 μg/mL can bind TNFRSF9(CSB-MP023984HU1), the EC50 is 2.671-3.702 ng/mL.
Target Names
TNFSF9
Uniprot NO.
Research Area
Cancer
Alternative Names
(4-1BB ligand) (4-1BBL)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
71-254aa
Target Protein Sequence
REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Mol. Weight
48.0 kDa
Protein Length
Partial
Tag Info
N-terminal hFc-Myc-tagged
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2 μg/ml can bind TNFRSF9(CSB-MP023984HU1), the EC50 is 2.671-3.702 ng/mL.
Description

The recombinant human TNFSF9 protein is an active protein generated in mammalian cells. Its expression region encodes the Arg71-Glu254 of human TNFSF9. It is tagged a human Ig1 Fc-Myc at the N-terminus. The purity of this TNFSF9 protein is greater than 90% measured by SDS-PAGE. It contains less than 1.0 EU endotoxin per ug protein determined by the LAL method. Its biological activity was assayed by binding toTNFRSF9 in a functional ELISA, and the EC50 is 2.671-3.702 ng/mL.

TNFSF9, also called 4-1BBL, is the natural ligand for TNFRSF9 (4-1BB) and is mainly expressed on activated antigen-presenting cells, including macrophages, monocytes, dendritic cells, B cells, and activated T cells. TNFSF9 is also detected on the surface of some cancer cells. TNFSF9 interacting with TNFRSF9 recruits TRAFs, especially TRAF2, activating the NF-κB pathway and MAPK pathway involving T cell activation, proliferation, differentiation, and apoptosis. TNFSF9/TNFRSF9 signaling has been found to mediate anti-tumor immune responses in immune cells such as T cells, NK cells, and APC, which suggests its potential to be a new antitumor biotherapy.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
Gene References into Functions
  1. CD137L-dendritic cells (CD137L-DCs) express high levels of adhesion molecules, display strong attachment. PMID:27431276
  2. TNFSF9 exerts an inhibitory effect on hepatocellular carcinoma and may be a tumor suppressor. PMID:28547807
  3. 4-1BB and 4-1BBL qualify as markers for prediction of patients' course and represent a valuable screening target for patients with acute myeloid leukemia at initial diagnosis. PMID:27388616
  4. the results from this study show that the costimulatory 4-1BB ligand fortifies an antigen-rich melanoma cell line with enhanced antigen-specific stimulation of CD8 T cells PMID:27564312
  5. the role of CD137-CRDI (cysteine rich domain I) in the binding of CD137-CD137L was further investigated. PMID:27430526
  6. blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation. PMID:26872462
  7. CD137L is overexpressed in non-small cell lung cancer specimens and positive expression of CD137L was associated with better overall survival. PMID:25631633
  8. In vitro immunotherapy is described for anti-prostate cancer effects of cytotoxic T lymphocytes induction by recombinant adenovirus mediated PSMA/4-1BBL dendritic cells. PMID:26125931
  9. vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer PMID:25872647
  10. Elevated plasma levels and monocyte-associated expression of CD137 ligand in patients with acute atherothrombotic stroke PMID:24899613
  11. Hence, the targeted combination of IL-15 and 4-BBL in the form of a trifunctional antibody-fusion protein is a promising new approach for cancer immunotherapy. PMID:24198185
  12. monocytes interact with iNKT cells to increase expression of 4-1BBL and 4-1BB, and in conjunction with this pathway, maintain their numbers at baseline. PMID:24639347
  13. TIRAP and IRAK2 are critical for the sustained inflammatory response that is mediated by late-phase signaling by the TLR-4-1BBL complex. PMID:24084649
  14. this is the first study to indicate that this member of the TNF superfamily, CD137, is modulated by SAHA treatment in breast PMID:22797667
  15. Data show that TNFR1 associates with CD137L and is required for CD137L reverse signaling. PMID:23620528
  16. CD137L is a novel diagnostic marker of subtypes of non-Hodgkin B-cell lymphomas. PMID:23095505
  17. signaling through CD137L in non-hematopoietic cells such as epithelial cells and endothelial cells has been shown to play an essential role in sterile inflammation by regulating immune cell recruitment. [Review] PMID:22526397
  18. Stimulation of non-adherent PBMC with OVCAR-3 cells expressing 4-1BB ligand (4-1BBL) or IL-12 resulted in preferential expansion of the NK cell population. PMID:22021067
  19. Data indicate that ex4-1BBL augments 4-1BB expression not only on the primed T cell, but also on DC. PMID:21745658
  20. The expression of CD137L might play an important role in the development of laryngeal carcinomas. PMID:20422976
  21. 4-1BBL and TRAF1 in the CD8 T cell response to influenza virus and HIV PMID:21153322
  22. K562-MICA-4-1BBL-IL-15 cells would be developed for expansion of NK cells ex vivo and may have important implications for clinical immunotherapy. PMID:20670353
  23. These data point to a hitherto unrecognized role of CD137 and CD137 ligand in multiple myeloma cell biology. PMID:20520765
  24. TNFSF9 mRNA levels in peripheral blood mononuclear cells may be associated with primary biliary cirrhosis progression. PMID:20303781
  25. Cocultures of Natural killer (NK) cells with CD137L transfectants confirmed that human CD137 inhibits NK-cell reactivity, while activating signals were transduced by its counterpart on NK cells in mice. PMID:20008791
  26. the structure of the trimer of human 4-1BB ligand is unique among members of the tumor necrosis factor superfamily PMID:20032458
  27. 4-1BBL and 4-1BB may have immunomodulatory functions, as shown by the anti-leukemia activity of MS-275 histone deacetylase inhibitor PMID:19759901
  28. 4-1BBL provides a costimulatory signal for T cell activation, thereby allowing T cell expansion as well as cytokine production and the development of cytolytic effector function. PMID:11994439
  29. Stimulation of 4-1BBL on DCs with 4-1BB-Fc or with 4-1BB-transfected Jurkat cells resulted in acquisition of capacity for the immature DCs to produce IL-12, suggesting that 4-1BBL may be an important mediator for maturation of CD11c(+) myeloid DCs PMID:12590704
  30. 4-1 BB ligand can costimulate human CD28- T cells, resulting in cell division, inflammatory cytokine production, increased perforin levels, enhancement of cytolytic effector function, as well as the up-regulation of the anti-apoptotic protein Bcl-X(L). PMID:12645943
  31. First evidence of expression and synthesis of CD137 and its ligand by human brain cells. PMID:13130507
  32. Data show that reverse signaling via 4-1BB-ligand enhanced interleukin-12beta mRNA and the secretion of IL-12 p70 in various antigen-presenting cells, including monocytes. PMID:14746806
  33. 4-1BB/4-1BBL and Fas/FasL pathways play important roles in vascular injury in Takayasu's arteritis. PMID:14752253
  34. Data suggest that levels of soluble 4-1BB and 4-1BB ligand in sera at the time of diagnosis may be indicative of the severity and outcome of rheumatoid arthritis. PMID:15031666
  35. trimeric CD137L (4-1BBL) requires cross-linking for its T cell co-stimulation activity PMID:16204238
  36. Signaling through 4-1BB-L allows B cells to proliferate and the expression of its ligand, by the intra-tumoral mesh of follicular dendritic cells (FDC), could thus serve as a paracrine loop facilitating growth and survival of MCL cells PMID:16287062
  37. Significantly lower CD137 ligand is associated with colorectal cancer patients PMID:16596186
  38. Elevated plasma levels of 4-1BBL in multiple sclerosis patients may function as a self-regulatory mechanism of the 4-1BB/4-1BBL pathway involved in the disease process. PMID:16970683
  39. Here we document a function for the TNF family member 4-1BB ligand (4-1BBL) in sustaining TLR-induced TNF production PMID:17496895
  40. Reverse signalling by CD137 ligand is mediated by protein tyrosine kinases, p38 mitogen activated protein kinase (MAPK), extracellular signal-regulated kinase (ERK)1,2, MAP/ERK kinase (MEK), Phosphoinositide-3-kinase (PI3-K) and protein kinase A (PKA). PMID:17855813
  41. selective immunosuppression through MSCs may perhaps occur partly through an increase in CD137L+ on T-lymphocytes PMID:17972956
  42. T cells that had become non-responsive to anti-CD3 could be reactivated to proliferate when costimulated with 4-1BBL, either alone or combined with CD80/CD86. PMID:17977894
  43. CD80 and 4-1BBL induce auto- and transcostimulation in tumor cells PMID:18026115
  44. deliver new insights into the multiple effects of reverse signaling of CD137L in human DC during the initiation of an adaptive immune response PMID:18395851
  45. PGE(2) induced the expression of the costimulatory molecules OX40L, CD70, and 4-1BBL on human dendritic cells. PMID:19029446
  46. in cells costimulated with CD80/86 that had downregulated CD28 expression and ceased to proliferate, reactivation of proliferation by 4-1BBL costimulation also restored their CD28 expression PMID:19217084
  47. (c)4-1BBL can be expressed on mononuclear blood cells in acute myeloid leukemia, myelodysplasia or non-Hodgkin lymphoma and can be coexpressed on lymphoid or myeloid malignant cells and on dendritic cells differentiated from AML-blasts. PMID:19225975
  48. reverse signaling of 4-1BBL promotes the differentiation of potent T(h)1-inducing dendritic cells from human monocytes. PMID:19684160

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Tissue Specificity
Expressed in brain, placenta, lung, skeletal muscle and kidney.
Database Links

HGNC: 11939

UNIGENE: Hs.1524

KEGG: hsa:8744

STRING: 9606.ENSP00000245817

OMIM: 606182

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products