Home
Product
Protein
Transmembrane Proteins
Recombinant Human Taste receptor type 2 member 3 (TAS2R3)

Recombinant Human Taste receptor type 2 member 3 (TAS2R3)

Code: CSB-CF889154HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4859

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TAS2R3

Uniprot NO.

Q9NYW6

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-316

Target Protein Sequence

MMGLTEGVFLILSGTQFTLGILVNCFIELVNGSSWFKTKRMSLSDFIITTLALLRIILLC IILTDSFLIEFSPNTHDSGIIMQIIDVSWTFTNHLSIWLATCLGVLYCLKIASFSHPTFL WLKWRVSRVMVWMLLGALLLSCGSTASLINEFKLYSVFRGIEATRNVTEHFRKKRSEYYL IHVLGTLWYLPPLIVSLASYSLLIFSLGRHTRQMLQNGTSSRDPTTEAHKRAIRIILSFF FLFLLYFLAFLIASFGNFLPKTKMAKMIGEVMTMFYPAGHSFILILGNSKLKQTFVVMLR CESGHLKPGSKGPIFS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5.

Gene References into Functions

differences in the bitterness from chemicals associated with genetic polymorphisms in bitter taste receptor genes, specifically in TAS2R3, -4, -5 as well as TAS2R38. PMID:26785164
Our results show that the expression rate of some of the T2R taste receptor genes was increased significantly in patients with phantogeusia. PMID:22397221
Includes the study of a polymorphic upstream ORF in this gene, and shows that it functions to reduce protein levels by ~58%. PMID:19372376

Hide All

Subcellular Location

Membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor T2R family

Tissue Specificity

Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in the antrum and fundus (part of the stomach), duodenum and in gastric endocrine cells.

Database Links

HGNC: 14910

UNIGENE: Hs.676011

KEGG: hsa:50831

STRING: 9606.ENSP00000247879

OMIM: 604868

Promotions