Home
Product
Protein
Transmembrane Proteins
Recombinant Human Taste receptor type 2 member 1 (TAS2R1)

Recombinant Human Taste receptor type 2 member 1 (TAS2R1)

Code: CSB-CF865184HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4732

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TAS2R1

Uniprot NO.

Q9NYW7

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-299

Target Protein Sequence

MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRKMAPLDLLLSCLAVSRIFLQL FIFYVNVIVIFFIEFIMCSANCAILLFINELELWLATWLGVFYCAKVASVRHPLFIWLKM RISKLVPWMILGSLLYVSMICVFHSKYAGFMVPYFLRKFFSQNATIQKEDTLAIQIFSFV AEFSVPLLIFLFAVLLLIFSLGRHTRQMRNTVAGSRVPGRGAPISALLSILSFLILYFSH CMIKVFLSSLKFHIRRFIFLFFILVIGIYPSGHSLILILGNPKLKQNAKKFLLHSKCCQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.

Gene References into Functions

TAS2R agonists block signaling downstream of phosphatidylinositol 3-kinase PMID:26684251
Expression and functional activity of the bitter taste receptors TAS2R1 and TAS2R38 in human keratinocytes PMID:25573083
Intracellular signaling and cell mechanics using isolated human airway smooth muscle, mouse tracheal responses, and human bronchial responses to characterize TAS2R relaxation in the context of beta(2)AR desensitization. PMID:22683571
The formation of a short helical segment in intracellular loop II may be necessary for the activation of hTAS2R1. PMID:21619450
Structural basis of activation of bitter taste receptor T2R1 and comparison with Class A G-protein-coupled receptors (GPCRs). PMID:21852241
The ligand binding pocket in T2R1 is present on the extracellular surface of the receptor, and is formed by the transmembrane helices 1, 2, 3 and 7 and with extracellular loops 1 and 2 forming a cap like structure on the binding pocket. PMID:20599705