RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
May act as a receptor in regulating T-cell proliferation.
Gene References into Functions
the present results support the notion that CD5 is not only a phenotypic marker but a relevant player in CLL cell biology, as demonstrated by the influence of germline-defined functional CD5 variants on CLL outcome.PMID:26991857
ZAP70 is the only gene that is differentially expressed in CD5-high and CD5-low normal B-lymphocytes, confirming the key role of Zap-70 tyrosine kinase in BCR signaling alterations in B-CLL.PMID:29125235
The high CD5 plasma levels in patients with severe ASD, probably indicated that CD5 might be implicated in the physiology of autism. However, this finding should be treated with caution until further investigations are performed with larger populations to determine whether the increase in plasma CD5 levels is a mere consequence of autism or it plays a pathogenic role in the disease.PMID:28406773
A CD34-negative MYC-rearranged B-lymphoblastic lymphoma aberrantly expresses CD3 and CD5.PMID:28280048
study provides understanding of the regulation of CD5 expression on leukaemic T cells, and may help in understanding the molecular mechanism of CD5 down-regulation.PMID:28752543
CD5 transcription is increased, leading to the production of three mRNA isoforms by APA, all contributing for protein production, at different levels. PTBP1 binds in the vicinity of pA1, leading to an increase in mRNA levels and miR-204 targets the longer CD5 mRNA.PMID:27005442
High CD5 expression is associated with lymphoma in Waldeyer ring.PMID:27616053
Thus, trans-signaling of IL-6 can only occur via sIL-6R, but not sCD5.PMID:28159554
The major proportion of CD5(low) B cells in patients are leukemic, thus identifying CD5(low) B cells as an important component of CLL, with implications for CLL pathogenesis, clinical monitoring, and the development of anti-CD5-directed therapies.PMID:27693386
the CD5 Pro224-Ala471 haplotype in homozygosis improved melanoma survival in the entire set of patients (HR = 0.27, 95% CI 0.11-0.67, Adj. p = 0.005). These findings highlight the relevance of genetic variability in immune-related genes for clinical outcome in melanoma.PMID:27169428
R-EPOCH therapy does not seem to impact the known poorer prognosis of patients with de novo CD5+ diffuse large B-cell lymphoma , and CD5 expression was still an independent prognostic factor in R-EPOCH-treated patients with diffuse large B-cell lymphoma.PMID:28039906
CD5+B lymphocytes were increased and activated in autoimmune hemolytic anemia patients.PMID:26968550
This study confirms the poor prognosis of de novo CD5+ DLBCL in a large multi-center cohort despite initial rituximab-containing chemotherapy and suggests that stem cell transplantation fails to salvage the majority of these patients.PMID:26800311
5.2 % were positive for CD5 and 5.7 % positive for epstein-Barr virus encoded RNAPMID:26369546
CD5 polymorphisms are associated with systemic lupus erythematosus.PMID:25402503
three tyrosine-based domains within CD5 cytoplasmic tail promote T-cell survival through non-overlapping mechanismsPMID:26363459
A case of mantle cell lymphoma with a unique pattern of CD5 negative to positive expression switching in relapse.PMID:24166616
useful in distinguishing thymic carcinoma from poorly differentiated lung carcinomaPMID:23958552
Data show that the proportion of CD5+ B cells at 1 mo of age is inversely correlated to total IgG levels at 18 and 36 mo of age.PMID:24928995
down-regulation of CD5 on activated CD8(+) T cells may serve as a useful marker of dysregulated T cell activation and proliferation in FHL2.PMID:24051121
CD5 expression in nodal marginal zone lymphoma correlates with a higher frequency of dissemination, but patients have an indolent clinical course and excellent overall survival.PMID:24124149
Our results indicate that CD5(+) B cell subsets might be associated with pathogenesis of SPMS.PMID:22732449
Functional CD5-dependent casein kinase 2 signaling is necessary in a CD5 knock-in mouse for efficient differentiation of naive CD4+ T cells into T helper (Th)2 and Th17 cells, but not Th1-type cells.PMID:22904299
Case Report: CD5-positive marginal zone B-cell lymphoma of the mucosa-associated lymphoid tissue (MALT) of the lung.PMID:22333190
Our results show that CD5 expression is rare in MALT lymphoma, and is often associated with nongastric disease and an increased tendency to present with disseminated disease.PMID:22406370
Hepatitis C virus infection of human T lymphocytes is mediated by CD5.PMID:22278227
The primary carcinoma showing thymus-like elements of the thyroid frequently expresses KIT and CD5 proteins.PMID:21835435
Alternative costimulation via CD5, rather than classic costimulation via CD28, primes naive T cells for stable Th17 development through promoting the expression of IL-23R.PMID:21926348
Post-thymic regulation of CD5 levels in human memory T cells is inversely associated with the strength of responsiveness to interleukin-15.PMID:21539877
immunological significance of CD19 for the IL-10 production by CD5(+) B cellsPMID:21786452
Case Report: describe the recurrence of CD5 positive MALT lymphoma in the oral cavity and compared the immunohistochemical expressions of CD5, lambda, and kappa between the primary and recurrent tumors.PMID:21892966
CD5 glycoprotein-mediated T cell inhibition dependent on inhibitory phosphorylation of Fyn kinasePMID:21757751
Conclude that high percentages of CD5+B cells independently associate with increased risk of early conversion to multiple sclerosis in clinically isolated syndrome patients.PMID:21436320
Data show that CD5 expression is associated with NFAT2 activity and mildly STAT3 activity, indicating that CD5 controls IL-10 secretion.PMID:21398617
full-length protein variant, encoded by E1A-cd5, translocates the phosphatase SHP-1 to the vicinity of the B-cell receptor, raises its threshold, and thereby limits the response of autoreactive B cells [review]PMID:21395509
CD5-positive splenic marginal zone lymphoma may be related to memory B-cell neoplasm or plasma cell differentiationPMID:21123968
Type B3 thymic epithelial tumor in an adolescent detected by immunohistochemical staining for CD5, CD99, and KIT (CD117): a case report.PMID:19901887
CD5-negative regulation of B cell receptor signaling originates from tyrosine residue Y429 outside an immunoreceptor tyrosine-based inhibitory motifPMID:11751967
Origins and functions of B-1 cells with notes on the role of CD5. Review.PMID:11861604
multiple somatic mutations in human cancers. the value of the CD5 microsatellite as a marker for instability in different tumor types, particularly in B-cell leukemia and lymphoma.PMID:11869933
CD5 supports the survival of B cells by stimulating IL-10 production and by concurrently exerting negative feedback on BCR-induced signaling events that can promote cell death.PMID:12393419
CD5-negative, CD10-negative small B-cell leukemia: variant of chronic lymphocytic leukemia or a distinct entityPMID:12447961
CD5 is rapidly recruited at the immunological synapse (IS) and lowers the T cell response elicited by antigen presentation by targeting downstream signaling events without affecting IS formation.PMID:12707340
The CD5+ diffuse large-B-cell lymphoma (DLBCL) constitutes a disease category distinct from that of CD5- DLBCL and other CD5+ malignancies.PMID:14603444
the 5'-flanking region of human CD5 is transcriptionally active in T cells, and Ets transcription factors in conjunction with other regulatory elements are responsible for constitutive and tissue-specific CD5 expressionPMID:15187131
Overexpression in these cells indicates diseaase progression in B=cell leukemia patients.PMID:15549146
CD5 is associated with receptor revision in activated mature B cells and likely to promote expression of suitable immunoglobulin gene receptors capable of initiating the germinal center reaction.PMID:15843554
The polymorphic CD5 promoter is associated with increased susceptibility to B-cell chronic lymphocytic leukemia and mantle cell lymphoma.PMID:15981803
balance between the 2 alternative exons 1 might be central to the regulation of membrane CD5 in human B cellsPMID:15998834
analysis of CD5-positive diffuse large B-cell lymphoma with the unusual phenotype of cytoplasmic CD20 (+), surface CD20 (-) [case report]PMID:16923582
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.