Recombinant Human Succinate receptor 1 (SUCNR1)

Code: CSB-CF022921HU

Rate （N/A）
Review （0）

Size:

20ug100ug

US$1620

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human SUCNR1 protein

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

SUCNR1

Uniprot NO.

Q9BXA5

Research Area

Signal Transduction

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-334aa

Target Protein Sequence

MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.2 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for succinate.

Gene References into Functions

activation of SUCNR1 in macrophages is important for both infiltration and inflammation of adipose tissue in obesity PMID:28382382
This study shows that metformin can attenuate activation of HSCs by activating the AMPK pathway and inhibiting the succinate-GPR91 pathway. Metformin has therapeutic potential for treating steatohepatitis and liver fibrosis. PMID:29278707
This study reports the expression of GPR91 on mouse and human mast cells and reveals a hyperactive behavior of mouse Sucnr1-/- mast cells in a mechanistic in vivo model of skin inflammation. PMID:27527650
Data show that succinate upregulates vascular endothelial growth factor (VEGF) expression by activation of signal transducer and activator of transcription 3 (STAT3) and extracellular regulated kinase (ERK)1/2 via its receptor G-protein coupled receptor 91 (GPR91). PMID:28061458
Succinate is abundant in synovial fluids from rheumatoid arthritis (RA) patients, and these fluids elicit IL-1beta release from macrophages in a GPR91-dependent manner. PMID:27481132
We give an exhaustive overview of the known and hypothetical signaling partners of SUCNR1 in different in vitro and in vivo systems and also discuss the link between SUCNR1 intracellular pathways and its pathophysiological roles. PMID:26808164
Through GPR91, succinate is involved in functions such as regulation of blood pressure, inhibition of lipolysis in white adipose tissue, development of retinal vascularization and cardiac hypertrophy. [review] PMID:26759054
The findings indicate that succinate-GPR91 signaling may be involved in right ventricular hypertrophy via PI3K/Akt signaling in vivo and in vitro. PMID:26824665
results show that succinate plays an important role in HSC activation through GPR91 induction, and suggest that succinate and GPR91 may represent new therapeutic targets for modulating hepatic fibrosis PMID:26051274
These results show for the first time that succinate plays an important role in cardiomyocyte hypertrophy through GPR91 activation and extend our understanding of how ischemia can induce hypertrophic cardiomyopathy PMID:25539979
These findings suggest that deficiency in SUCNR1 is a possible contributing factor to the pathogenesis of dry age-related macular degeneration. PMID:23833031
results show that GPR91 when expressed in HEK293s cells couples exclusively through the Galphai pathway and acts through Galphai not only to inhibit cAMP production but also to increase intracellular Ca(2+) PMID:23770096
A review of how neuron-derived factors, GPR91 and Semaphorin 3A, guide retinal vascularization and are major contributors to the pathogenesis of retinopathy of prematurity . PMID:22497252
Succinate stimulates cell proliferation through GPR91 and requires activation of the Erk MAPK pathway. PMID:19204147
This paper describes function in another species. PMID:15141213
GPR91 is a receptor for succinate and mediates succinate-induced hypertension. PMID:15141213