Recombinant Human Sphingosine 1-phosphate receptor 4 (S1PR4)

Code: CSB-CF020653HU
Size:
20μg
20μg100μg
US$5368
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
S1PR4
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-384
Target Protein Sequence
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS FRGSRSLSFRMREPLSSISSVRSI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. May be involved in cell migration processes that are specific for lymphocytes.
Gene References into Functions
  1. High S1PR4 expression is associated with anti-neutrophil cytoplasmic antibody-associated vasculitis. PMID:28206609
  2. S1PR4 missense mutation is associated with variant blood cell traits. PMID:27399967
  3. Shear stress did not induce rapid dephosphorylation of beta-arrestin-1 or rapid internalization of S1P3, indicating no GPCR activation. These findings suggest that Galphaq/11 participates in the sensing/transducing of shear stress independently of GPCR activation in ECs. PMID:28148497
  4. Ig-like transcript 7 is rapidly internalized upon receptor-mediated endocytosis of TLR7/9 ligands to allow high IFN-alpha production. This is antagonized by S1PR4 signaling, thus decreasing TLR-induced IFN-alpha secretion. PMID:26783340
  5. S1P2 translocation to the nucleus is regulated by an autocrine loop involving S1P and S1P4. In contrast, the translocation of Y416 phosphorylated c-Src to the nucleus appears to be regulated by a mechanism that does not involve S1P3 or S1P4. PMID:24486401
  6. analysis of novel potent and selective sphingosine-1-phosphate 4 receptor (S1P-R) agonists PMID:22119461
  7. findings highlight an important role for S1P(4) and SK1 in ER(-) breast cancer progression. PMID:22460268
  8. Data show that S1P4 uses HER2 to regulate extracellular signal regulated kinase-1/2 MDA-MB-453 breast cancer cells. PMID:20837468
  9. Data report that sphingosine 1-phosphate receptor 4 (S1P(4)) is specifically up-regulated during the development of human megakaryocytes from progenitor cells PMID:20686109
  10. Mutation of the ligand selectivity residue from glutamic acid to glutamine confers lysophosphatidic acid sensitivity with preference for short-chain species PMID:15298705
  11. FOXO1 controls the expression of L-selectin and EDG1 and EDG6, receptors that regulate lymphocyte trafficking PMID:18713968

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Specifically expressed in fetal and adult lymphoid and hematopoietic tissue as well as in lung. Considerable level of expression in adult and fetal spleen as well as adult peripheral leukocytes and lung. Lower expression in adult thymus, lymph node, bone
Database Links

HGNC: 3170

UNIGENE: Hs.662006

KEGG: hsa:8698

STRING: 9606.ENSP00000246115

OMIM: 603751

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products