Recombinant Human Sphingosine 1-phosphate receptor 3 (S1PR3)

CSB-CF859932HU
Size:
20μg
20μg100μg
US$5323
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
S1PR3
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-378
Target Protein Sequence
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP SSCIMDKNAALQNGIFCN
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis.
Gene References into Functions
  1. Reactive astrocytic S1P3 signaling modulates the blood-tumor barrier in brain metastases. PMID:30006619
  2. Authors found that elevated levels of pSphK1 were positive correlation with high expression of S1P, which in turn promoted metastasis of TNBC through S1P/S1PR3/Notch signaling pathway. PMID:29605826
  3. Sphingosine-1-phosphate receptor 3 (S1PR3) mediates multiple aspects of the inflammatory response during sepsis. PMID:28850247
  4. in breast cancer cells overexpression of S1P3 and its activation by S1P has pro-inflammatory and pro-metastatic potential by inducing COX-2 expression and PGE2 signaling via EP2 and EP4. PMID:27616330
  5. High S1PR3 expression is associated with increased lung adenocarcinoma. PMID:27856637
  6. The study shows that S1P receptor 3 (S1PR3) mRNA is overexpressed in EBV-positive NPC patient-derived xenografts and a subset of primary NPC tissues, and that knockdown of S1PR3 suppressed the activation of AKT and the S1P-induced migration of NPC cells. PMID:28240350
  7. S1pr3 promotes leukocyte rolling by mobilization of endothelial P-selectin. PMID:25832730
  8. Stimulation with sphingosine-1-phosphate enhances cancer stem cells via S1PR3 and subsequent Notch1 activation. PMID:25254944
  9. TRPC1 functions as a major regulator of S1P3 and VEGFR2 expression. PMID:25971967
  10. Data indicate that sphingosine 1-phosphate (S1P) and hepatocyte growth factor (HGF) induced transloaction of integrin beta4, S1P receptors S1PR2 and S1PR3 to endothelial cell membrane caveolin-enriched microdomains (CEMs). PMID:24851274
  11. a novel signaling axis, i.e., ROCK-JNK-ETS-1-CD44 pathway, which plays an essential role in the S1P3-regulated chemotactic response. PMID:24064218
  12. associations were found for 2 promoter SNPs across 2 European descent samples supporting association of alleles -1899G and -1785C with decreased risk for sepsis-associated acute respiratory distress syndrome (ARDS); alleles reduced transcription factor binding to S1PR3 promoter and S1PR3 promoter activity; associated with lower plasma S1PR3 protein in ARDS patients PMID:23911438
  13. Sphingosine 1-phosphate receptor 3 regulates recruitment of anti-inflammatory monocytes to microvessels during implant arteriogenesis. PMID:23918395
  14. S1PR agonists are pro-fibrotic via S1P2R and S1P3R stimulation using Smad-independent pathways. PMID:23589284
  15. S1P3 receptors are detected in virtually all neurons in dorsal root ganglion and mediate pain behavior. PMID:23392686
  16. Inhibition of S1P3 receptors prevented E2-induced activation of Cdc42, supporting the important role of the S1P receptor in E2 signaling. PMID:23142484
  17. S1PR3 is nitrated on specific tyrosine residues and released as endothelial cell microparticles during acute lung injury. PMID:22771388
  18. Suggest that the enhanced S1P3-EGFR signaling axis may contribute to the tumorigenesis or progression of lung adenocarcinomas. PMID:22344462
  19. S1PR3 was higher in iliac-femoral arteries compared with carotid arteries. PMID:22308044
  20. S1P regulates MMP-9 induction and invasiveness through coupling of S1P3 and G(alphaq) in MCF10A cells, thus providing a molecular basis for the crucial role of S1P in promoting breast cell invasion. PMID:21652634
  21. These results suggest a potential role for HDL and S1P receptors in the pathogenesis of prostate cancer. PMID:20979115
  22. The follicular fluid-HDL-associated S1P promotes granulosa lutein cell migration via S1PR3 and RAC1 activation. This may represent a novel mechanism contributing to the development of the corpus luteum. PMID:20980685
  23. amplification of SHC3 and EDG3 genes suggests that the two proteins co-operate and are important for ependymomas in vivo. PMID:19748727
  24. a 9-amino acid peptide (KRX-725), derived from the second intracellular loop of S1P3 (EDG3) mimics sphingosine 1-phosphate (S1P) by triggering a Gi-dependent mitogen-activated protein kinase kinase and extracellular signal-regulated kinase signal. PMID:12763936
  25. S1P(3) function is not subject to conventional regulation by GRK phosphorylation PMID:15894172
  26. Expression of the sphingosine 1 phosphate receptor in primary endothelial cells is both sufficient and necessary for the expression of Akt3. PMID:16527273
  27. Reults describe the role of mu opioid receptors and S1P3 transactivation in the attenuation of vascular permeability by methylnaltrexone. PMID:17395891
  28. Cytosolic phospholipase A2alpha activation induced by S1P is mediated by the S1P3 receptor in lung epithelial cells.( PMID:18502815
  29. Results suggest that S1PR3 is involved in COX2 dependent effects of high-density lipoprotein on vascular smooth muscle. PMID:18612546
  30. Report different response patterns of several ligands at the sphingosine-1-phosphate receptor subtype 3 (S1P(3)). PMID:19309361

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.
Database Links

HGNC: 3167

UNIGENE: Hs.585118

KEGG: hsa:1903

STRING: 9606.ENSP00000350878

OMIM: 601965

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products