Recombinant Human Sphingosine 1-phosphate receptor 3 (S1PR3)

Code: CSB-CF859932HU
Size:
20μg
20μg100μg
US$5323
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
S1PR3
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-378
Target Protein Sequence
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP SSCIMDKNAALQNGIFCN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis.
Gene References into Functions
  1. Reactive astrocytic S1P3 signaling modulates the blood-tumor barrier in brain metastases. PMID:30006619
  2. Authors found that elevated levels of pSphK1 were positive correlation with high expression of S1P, which in turn promoted metastasis of TNBC through S1P/S1PR3/Notch signaling pathway. PMID:29605826
  3. Sphingosine-1-phosphate receptor 3 (S1PR3) mediates multiple aspects of the inflammatory response during sepsis. PMID:28850247
  4. in breast cancer cells overexpression of S1P3 and its activation by S1P has pro-inflammatory and pro-metastatic potential by inducing COX-2 expression and PGE2 signaling via EP2 and EP4. PMID:27616330
  5. High S1PR3 expression is associated with increased lung adenocarcinoma. PMID:27856637
  6. The study shows that S1P receptor 3 (S1PR3) mRNA is overexpressed in EBV-positive NPC patient-derived xenografts and a subset of primary NPC tissues, and that knockdown of S1PR3 suppressed the activation of AKT and the S1P-induced migration of NPC cells. PMID:28240350
  7. S1pr3 promotes leukocyte rolling by mobilization of endothelial P-selectin. PMID:25832730
  8. Stimulation with sphingosine-1-phosphate enhances cancer stem cells via S1PR3 and subsequent Notch1 activation. PMID:25254944
  9. TRPC1 functions as a major regulator of S1P3 and VEGFR2 expression. PMID:25971967
  10. Data indicate that sphingosine 1-phosphate (S1P) and hepatocyte growth factor (HGF) induced transloaction of integrin beta4, S1P receptors S1PR2 and S1PR3 to endothelial cell membrane caveolin-enriched microdomains (CEMs). PMID:24851274
  11. a novel signaling axis, i.e., ROCK-JNK-ETS-1-CD44 pathway, which plays an essential role in the S1P3-regulated chemotactic response. PMID:24064218
  12. associations were found for 2 promoter SNPs across 2 European descent samples supporting association of alleles -1899G and -1785C with decreased risk for sepsis-associated acute respiratory distress syndrome (ARDS); alleles reduced transcription factor binding to S1PR3 promoter and S1PR3 promoter activity; associated with lower plasma S1PR3 protein in ARDS patients PMID:23911438
  13. Sphingosine 1-phosphate receptor 3 regulates recruitment of anti-inflammatory monocytes to microvessels during implant arteriogenesis. PMID:23918395
  14. S1PR agonists are pro-fibrotic via S1P2R and S1P3R stimulation using Smad-independent pathways. PMID:23589284
  15. S1P3 receptors are detected in virtually all neurons in dorsal root ganglion and mediate pain behavior. PMID:23392686
  16. Inhibition of S1P3 receptors prevented E2-induced activation of Cdc42, supporting the important role of the S1P receptor in E2 signaling. PMID:23142484
  17. S1PR3 is nitrated on specific tyrosine residues and released as endothelial cell microparticles during acute lung injury. PMID:22771388
  18. Suggest that the enhanced S1P3-EGFR signaling axis may contribute to the tumorigenesis or progression of lung adenocarcinomas. PMID:22344462
  19. S1PR3 was higher in iliac-femoral arteries compared with carotid arteries. PMID:22308044
  20. S1P regulates MMP-9 induction and invasiveness through coupling of S1P3 and G(alphaq) in MCF10A cells, thus providing a molecular basis for the crucial role of S1P in promoting breast cell invasion. PMID:21652634
  21. These results suggest a potential role for HDL and S1P receptors in the pathogenesis of prostate cancer. PMID:20979115
  22. The follicular fluid-HDL-associated S1P promotes granulosa lutein cell migration via S1PR3 and RAC1 activation. This may represent a novel mechanism contributing to the development of the corpus luteum. PMID:20980685
  23. amplification of SHC3 and EDG3 genes suggests that the two proteins co-operate and are important for ependymomas in vivo. PMID:19748727
  24. a 9-amino acid peptide (KRX-725), derived from the second intracellular loop of S1P3 (EDG3) mimics sphingosine 1-phosphate (S1P) by triggering a Gi-dependent mitogen-activated protein kinase kinase and extracellular signal-regulated kinase signal. PMID:12763936
  25. S1P(3) function is not subject to conventional regulation by GRK phosphorylation PMID:15894172
  26. Expression of the sphingosine 1 phosphate receptor in primary endothelial cells is both sufficient and necessary for the expression of Akt3. PMID:16527273
  27. Reults describe the role of mu opioid receptors and S1P3 transactivation in the attenuation of vascular permeability by methylnaltrexone. PMID:17395891
  28. Cytosolic phospholipase A2alpha activation induced by S1P is mediated by the S1P3 receptor in lung epithelial cells.( PMID:18502815
  29. Results suggest that S1PR3 is involved in COX2 dependent effects of high-density lipoprotein on vascular smooth muscle. PMID:18612546
  30. Report different response patterns of several ligands at the sphingosine-1-phosphate receptor subtype 3 (S1P(3)). PMID:19309361

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.
Database Links

HGNC: 3167

UNIGENE: Hs.585118

KEGG: hsa:1903

STRING: 9606.ENSP00000350878

OMIM: 601965

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products