Home
Product
Protein
Transmembrane Proteins
Recombinant Severe acute respiratory syndrome coronavirus ORF3a protein (3a)

Recombinant Severe acute respiratory syndrome coronavirus ORF3a protein (3a)

Code: CSB-CF349531HQE

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4545

Quantity:

Express system: in vitro E.coli expression system

Species: Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Uniprot NO.

P59632

Alternative Names

3a; ORF3a protein; Accessory protein 3a; Protein 3a; Protein U274; Protein X1

Species

Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Source

in vitro E.coli expression system

Expression Region

1-274

Target Protein Sequence

MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSAT KIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINA CRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPYNSVTDTIVVTEGDGISTPKL KEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDP PNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Forms homotetrameric potassium sensitive ion channels (viroporin) and may modulate virus release. Up-regulates expression of fibrinogen subunits FGA, FGB and FGG in host lung epithelial cells. Induces apoptosis in cell culture. Downregulates the type 1 interferon receptor by inducing serine phosphorylation within the IFN alpha-receptor subunit 1 (IFNAR1) degradation motif and increasing IFNAR1 ubiquitination.

Subcellular Location

Virion. Host Golgi apparatus membrane; Multi-pass membrane protein. Host cell membrane; Multi-pass membrane protein. Secreted. Host cytoplasm. Note=The cell surface expressed protein can undergo endocytosis. The protein is secreted in association with membranous structures.

Promotions

Email: support@cusabio.com
Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

FCGR3A: A Key Receptor for Immune Regulation Metabolic Hub, Reprogramming Disease: SLC3A2 – From Amino Acid Transport Mechanism to Emerging Therapeutic Target CUSABIO's Five Expression Systems How to express a protein with bioactivity?How to choose a suitable expression vector?How to Choose the Right Recombinant Protein for Your Experimental Model?How to Properly Reconstitute Lyophilized Proteins?Verified vs. Unverified Recombinant Proteins: Making the Right Choice for Your Research Approaches to Determinate Protein Concentration Exploring Protein-Protein Interactions: A Comprehensive Guide to Understanding and Utilizing It What Is Protein Characterization: Definition, Examples, Methods, and Techniques Protein Tags: A Comprehensive Overview

Recombinant Severe acute respiratory syndrome coronavirus ORF3a protein (3a)

Product Details

Related Products

Customer Reviews and Q&A

Target Background