DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Gene References into Functions
Our results suggest that betacellulin induces ovarian cancer migration and Slug-dependent E-cadherin down-regulationPMID:27129169
CXCL8 production from lung cancer cells could be initiated by an autocrine mechanism or external sources of BTC.PMID:24629040
Data suggest that BTC (betacellulin), AREG (amphiregulin), and EREG (epiregulin) induced prostaglandin E2 production by induction of COX-2 (prostaglandin-endoperoxide synthase 2) through MAP kinase signaling in granulosa cells.PMID:24092824
BTC has properties of increasing retinal vascular leakage that could contribute to the development of diabetic retinopathy.PMID:22183345
Data suggest a novel receptor-independent role for betacellulin intracellular-domain fragment signaling due to its ability to inhibit cell growth in vitro.PMID:20530572
These are the first data that demonstrate an influence of betacellulin upon mesenchymal stem cells and the first to implicate HIF-alpha in betacellulin-mediated proliferation.PMID:20165885
The solution structure of the EGF-like domain of betacellulin has been determined using two-dimensional nuclear magnetic resonance spectroscopyPMID:12074582
The main structural properties of the model and the templates are compared and the hBTC conformation is closely similar to that of hTGFalpha.PMID:12111392
Betacellulin and heregulin/NDF-alpha are involved in epidermal morphogenesis and/or in maintenance of the differentiated phenotype.PMID:12768307
although BTC and EGF share overlapping signaling properties, the ability of BTC to enhance Erk activation occurs independent of Ras.PMID:15192046
BTC may play a pivotal role as a local growth factor in promoting the differentiated villous trophoblastic function via ErbB-1 in early placentas and in contributing to placental growth through EVT cell function via ErbB-4 in term placentas.PMID:15248827
Betacellulin is expressed in malignant fibrous histiocytoma and is a regulator of tumor growth.PMID:15274392
shedding of precursor is mediated by ADAM10PMID:15507448
To determine if mutations in the betacellulin gene play a role in the development of type 2 diabetes, we screened subjects with type 2 diabetes for the presence of mutations.PMID:15793259
Genetic variations in the protein-coding region of the human BTC gene are unlikely to be a major contributor to development of type 2 diabetes.PMID:15936459
-226A/G polymorphism of the BTC gene may contribute to the development of diabetes.PMID:16306376
intron 4 T-4 allele in the betacellulin gene is associated with lower risk of type 1 diabetes mellitus and may interact with human leukocyte antigenPMID:16683131
Failure to confirm a role for nonsynonymous coding variants of betacellulin in the propensity to type 2 diabetes or to impaired insulin secretion in African American subjects.PMID:16869959
Variants in the betacellulin gene do not play a major role in the development of type 2 diabetes in an Amish Caucasian populationsPMID:17479438
the ADAM10 prodomain inhibits betacellulin shedding, demonstrating that it could be of potential use as a therapeutic agent to treat cancer.PMID:17895248
1st report of BTC expression in breast cancer. Its expression was lower in lobular breast cancers than in ductal carcinomas.PMID:17962208
These results indicate the possibility of designing BTC mutants, which have an activity of inducing differentiation only, without facilitating growth promotion.PMID:18508082
In vivo, EGFR signaling is hyperactive in tumor cells of skin SCC but not of BCC, and in nearby asymptomatic epidermis of both tumor types. Hyperactivation is due to upregulation of EGFR ligands AREG, HBEGF and TGFA, and downregulation of BTCPMID:17525275
Show
More
Hide
All
Subcellular Location
[Betacellulin]: Secreted, extracellular space.; [Probetacellulin]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.