Recombinant Human Potassium channel subfamily K member 10 (KCNK10)

Code: CSB-CF012063HU
Size:
20μg
20μg100μg
US$6520
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
KCNK10
Uniprot NO.
Alternative Names
KCNK10; TREK2; Potassium channel subfamily K member 10; Outward rectifying potassium channel protein TREK-2; TREK-2 K(+ channel subunit
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-538
Target Protein Sequence
MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQ GGLQTVMKWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVS PQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFI LAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV EIHDKLQRAATIRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRP NNLRLKGPEQLNKHGQGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYS LDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents. Activated by arachidonic acid and other naturally occurring unsaturated free fatty acids.
Gene References into Functions
  1. The M2-glycine hinge controls the macroscopic currents of TREK1 channels. PMID:28676394
  2. This study showed that KCNK10 gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders. PMID:26381449
  3. The selectivity filter conformations of alternative translation initiation isoforms and wild type human TREK-2 are similar in the S4 site and pHo position. PMID:26271386
  4. Results suggest that the cytosolic C-terminal domain and the bottom of transmembrane segment M2 are required for the 2-aminoethoxydiphenyl borate activation on TREK-2 channels PMID:25982558
  5. How ion channels sense mechanical force: insights from mechanosensitive K2P channels TRAAK, TREK1, and TREK2. PMID:26332952
  6. Modulation of K2P 2.1 and K2P 10.1 K(+) channel sensitivity to carvedilol by alternative mRNA translation initiation PMID:25168769
  7. PLD2, but not PLD1, directly binds to the C terminus of TREK1 and TREK2. PMID:25197053
  8. crystal structures of TREK-2 channel in 2 conformations and in complex with norfluoxetine, a state-dependent blocker of TREK channels; results provide an explanation for TREK channel mechanosensitivity, regulation by diverse stimuli and possible off-target effects of Prozac PMID:25766236
  9. High TREK-2 expression is associated with epithelial ovarian cancer. PMID:23479219
  10. Tissue-specific mRNA splicing regulates alternative translation initiation (ATI) of human K(2P)10.1 K+ background channels via recombination of 5 nucleotide motifs. PMID:21669980
  11. Expression pattern and functional characteristics of two novel splice variants of the two-pore-domain potassium channel TREK-2. PMID:11897838
  12. Predicts the role of TREK-2 in brain ischemia, memory and other tissues.[REVIEW] PMID:17689202

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity
Abundantly expressed in pancreas and kidney and to a lower level in brain, testis, colon, and small intestine. Isoform b is strongly expressed in kidney (primarily in the proximal tubule) and pancreas, whereas isoform c is abundantly expressed in brain.
Database Links

HGNC: 6273

UNIGENE: Hs.560255

KEGG: hsa:54207

STRING: 9606.ENSP00000310568

OMIM: 605873

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products