Recombinant Human P2Y purinoceptor 11 (P2RY11)

Code: CSB-CF846624HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5293

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

P2RY11

Uniprot NO.

Q96G91

Alternative Names

P2RY11; P2Y purinoceptor 11; P2Y11

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-374

Target Protein Sequence

MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRP WHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFI TCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNC SVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTV AEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPY VGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATA APKPSEPQSRELSQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP.

Gene References into Functions

these results show hepatocellular carcinoma-specific expression of the P2Y11 receptor and its critical role in mediating ATP-inducing Ca2+ signalling and regulating cancer cell migration PMID:28418839
Decreased P2Y11 signaling plays an important role in the development of narcolepsy with cataplexy. PMID:28460015
Hypoxia/reoxygenation inhibits P2y11 receptor expression and its immunosuppressive activity in human dendritic cells. PMID:26078273
Suggest role for LXA4 in stimulating apical ATP secretion via pannexin-1 channels and P2RY11 purinoreceptors activation leading to an airway surface liquid layer height increase and epithelial repair. PMID:24588705
vesicular exocytosis of ATP and autocrine, positive feedback through P2Y11 receptors is required for the effective activation of macrophages PMID:23577075
P2Y11 receptor mediates interferon gamma-induced IL-6 production in HaCaT cells, suggesting the importance of purinergic signaling in interferon-gamma induced skin inflammatory conditions PMID:23461851
P2Y11 receptors are abundantly and diffusely expressed intracellularly in skeletal muscle fibers. PMID:22052557
The study extends on the observation of a strong multiethnic association of polymorphisms in the TCRA and P2RY11 with narcolepsy, but does not confirm the association of CPT1B/CHKB (rs5770917) in the Chinese population. PMID:22177342
Extracellular NAD stimulates mesenchymal stem cell functions through activation of P2Y11 receptor. PMID:20964598
Common variants in P2RY11 are associated with narcolepsy. PMID:21170044
Inhibition of Natural killer cell response to CX3CL1 is mediated by the P2Y11 receptor. PMID:20668227
beta-NAD(e)+ is an agonist of the P2Y(11) purinoceptor and P2Y(11) is the endogenous receptor in granulocytes mediating the sustained [Ca2+]i increase responsible for their functional activatio PMID:16926152
We propose that residues Arg106, Arg268, Arg307 and Glu186 are involved in ionic interactions with the phosphate moiety of ATP. Arg307 is possibly also H-bonded to N6 of ATP via the backbone carbonyl. PMID:17338680
In human granulocytes, endogenous P2Y(11) proved to be responsible for NAADP+-induced cell activation, unveiling a role of NAADP+ as a pro-inflammatory cytokine. PMID:17707504
The P2 receptor mediating the antiapoptotic actions of ATP was identified using a combination of more selective ATP analogs, receptor expression studies, and study of downstream signaling pathways. PMID:18056402
present data clearly show that P2Y purinoceptor 11 and P2Y purinoceptor 12 are expressed in human pancreatic islets PMID:18726826