MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.1 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Gene References into Functions
Study provides the first demonstration that OX1R is aberrantly expressed in the inflamed mucosa of ulcerative colitis patients, both in the epithelial and immune cells.PMID:30251681
In this study we demonstrate a new role of MRAP2 in the regulation of the orexin receptor 1 (OX1R) and identify the specific regions of MRAP2 required for the regulation of OX1R and PKR1. Importantly, like MC4R and PKRs, OX1R is predominately expressed in the brain where it regulates food intakePMID:28939058
After sequencing all orexin receptor exons, one variation (rs2271933) in the OX1R gene and one variation (rs2653349) in the OX2R gene were found. However, no significant differences were found in either genotypic or allelic frequency distributions between the two study groupsPMID:27988352
G-protein-dependency of OX1 receptor signallingPMID:27237973
Several single nucleotide polymorphisms (SNPs) in HCRTR2 were nominally associated with Antipsychotic-induced weight gain (AIWG) in patients of European ancestry treated with either clozapine or olanzapine. None of the SNPs in HCRTR1 were associated with AIWG.PMID:26447462
Rapid-onset obesity with hypothalamic dysfunction, hypoventilation, and autonomic dysregulation is highly unlikely to be caused by mutations in the exons of the HCRTR1 gene.PMID:26555080
This study determined structures of OX1R bound to the OX1R-selective antagonist SB-674042 and the dual antagonist suvorexant at 2.8-A and 2.75-A resolution.PMID:26950369
the orexinA/OX1 receptor axis has a significant pro-survival function in adrenal cells.PMID:26459696
OX1R signaling can attenuate KOR-mediated reduction of cellular cAMP levels while enhancing KOR-mediated beta-arrestin recruitment and p38 activation.PMID:25857454
OX1R and KOR heterodimerize, and this heterodimer associates with Galphas, leading to increased protein kinase A (PKA) signaling pathway activity, including upregulation of intracellular cAMP levels.PMID:25866368
No significant differences were found in the distribution of either genotypic or allelic frequencies between Alzheimer's disease cases and controls in the HCRTR1 polymorphisms.PMID:24969517
Orexins modifiy orexin receptor gene expression and gonadotropin release from the anterior pituitary gland.PMID:24333629
DQ B1 but not HLA-DR typing, TNF-alpha levels, HCRTR1 and HCRTR2 were higher in narcolepsy-cataplexy/schizophrenia patients.PMID:24268496
The present data indicate that OX1R-driven apoptosis is overexpressed in androgeno-independent prostate cancer exhibiting a neuroendocrine differentiation opening a gate for novel therapies for these aggressive cancers which are incurable until now.PMID:24910418
Both orexin receptor subtypes, OX1R and OX2R, and CB1 cannabinoid receptors are capable of forming constitutive homo- and heteromeric complexes.PMID:24530395
[review] Native orexin peptides consist of receptor agonists, orexin-A (33 amino acids) and orexin-B (28 amino acids) (aka hypocretin-1 and hypocretin-2).PMID:23034387
Orexin receptors generate potent endocannabinoid signals in addition to arachidonic acid signals, which may explain the proposed orexin-cannabinoid interactions.PMID:22550093
decreased ventilatory responses to hypoxia in human narcolepsy-cataplexy is in relation to HLA-DQB1*0602 status, not hypocretin deficiencyPMID:21318258
Intramolecular fluorescence resonance energy transfer (FRET) sensors of the orexin OX1 and OX2 receptors identify slow kinetics of agonist activation.PMID:22389503
HCRTR1 gene could represent a genetic susceptibility factor for migraine without aura; the hypocretin system may have a role in the pathophysiology of migraine.PMID:21344296
The Ile408Val polymorphism in the hypocretin receptor 1 (HCRTR1) gene and the Val308Iso (G1246A) polymorphism in the hypocretin receptor 2 (HCRTR2) gene in a sample of 215 panic disorder patients and 454 controls, were analyzed.PMID:21666548
Data show that the HCRTR1 gene or a linked locus may modulate the risk for Major Mood Disorders and supports recent studies suggesting an involvement of hypocretin neurotransmitter system in affective disorders.PMID:21071097
Results show that the N-terminal regions of orexin receptor are most important, and the exchange of the area from the C-terminal part of the transmembrane helix 2 to the transmembrane helix 4 is enough to lead to a change of the receptor's ligand profile.PMID:21510948
analysis of orexin receptor 1 and 2 -arrestin-ubiquitin complexesPMID:21378163
In differentiated IMR-32 neuroblastoma cells orexin/hypocretin and bradykinin receptors activate TRPC3/6 channels.PMID:20728215
Data demonstrate the functional role of protein kinase D1 and protein kinase D3 in modulating physiological responses to Ox1R activation.PMID:20621130
OX1 orexin receptor activation results in robust arachidonic acid release.PMID:20002100
It was shown here that another motif, immunoreceptor tyrosine-based switch motif, is present in orexin receptor-1 (OX1R) and is mandatory for OX1R-mediated apoptosis.PMID:19661287
The SK-N-MC cell line expresses an orexin binding site different from recombinant orexin 1-type receptor.PMID:11856342
evidence that CB1 is able to potentiate an orexigenic receptor, OX1RPMID:12690115
both OX1R and OX2R are expressed in the testis, epididymis, penis, and seminal vesiclePMID:15070969
OX(1) receptors stimulate adenylyl cyclase via a low potency G(s) coupling and a high potency phospholipase C --> PKC coupling.PMID:15611118
All adrenal corttex adenomas expressed OX1-R and OX2-R mRNAs, and real-time PCR showed that the expression of both receptors was up-regulated in adenomasPMID:15797953
Our preliminary data suggest that mutation hcrtr1 might have an increased susceptibility to polydipsia through an undetermined mechanism.PMID:15978554
Orexins act exclusively through OX1-receptors coupled to the adenylate cyclase/protein kinase A-dependent signaling cascade.PMID:16157481
OX1 orexin/hcrtr-1 hypocretin receptors induce caspase-dependent and -independent cell death through p38 mitogen-/stress-activated protein kinasePMID:16282319
This is the first demonstration of loss of Hcrt/Orx neurons in MSA, which is consistent with a system degeneration of neurons involved in homeostatic function, including sleep and autonomic regulation, in this disorder.PMID:17089135
Results support the hypothesis that the HCRTR1 Ile408Val polymorphism may confer susceptibility to polydipsia in schizophrenia.PMID:17999203
orexin-induced apoptosis is driven by an immunoreceptor tyrosine-based inhibitory motif (ITIM) present in the OX1R and is mediated by SHP-2 phosphatase recruitment via a mechanism that requires Gq protein but is independent of phospholipase C activation.PMID:18198212
Both sporadic narcoleptic dogs and human narcolepsy-cataplexy subjects showed a significant decrease in hcrtR1 expression, while declines in hcrtR2 expression were not significant in these cases.PMID:18714784
Induction of intracellular calcium signaling in isolated duodenal enterocytes is mediated primarily by OX1R receptorsPMID:19118115
OX1R are able to activate TRPC(3)-channel-dependent oscillatory responses independently of store discharge.PMID:19464259