Recombinant Human Orexin/Hypocretin receptor type 1 (HCRTR1), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Name:HCRTR1
Uniprot NO.
Alternative Names
HCRTR1; Orexin/Hypocretin receptor type 1; Hypocretin receptor type 1; Orexin receptor type 1; Ox-1-R; Ox1-R; Ox1R
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
1-46
Target Protein Sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
N-terminal His-tagged and C-terminal Myc-tagged/N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding.
Gene References into Functions
  1. Study provides the first demonstration that OX1R is aberrantly expressed in the inflamed mucosa of ulcerative colitis patients, both in the epithelial and immune cells. PMID:30251681
  2. In this study we demonstrate a new role of MRAP2 in the regulation of the orexin receptor 1 (OX1R) and identify the specific regions of MRAP2 required for the regulation of OX1R and PKR1. Importantly, like MC4R and PKRs, OX1R is predominately expressed in the brain where it regulates food intake PMID:28939058
  3. After sequencing all orexin receptor exons, one variation (rs2271933) in the OX1R gene and one variation (rs2653349) in the OX2R gene were found. However, no significant differences were found in either genotypic or allelic frequency distributions between the two study groups PMID:27988352
  4. G-protein-dependency of OX1 receptor signalling PMID:27237973
  5. Several single nucleotide polymorphisms (SNPs) in HCRTR2 were nominally associated with Antipsychotic-induced weight gain (AIWG) in patients of European ancestry treated with either clozapine or olanzapine. None of the SNPs in HCRTR1 were associated with AIWG. PMID:26447462
  6. Rapid-onset obesity with hypothalamic dysfunction, hypoventilation, and autonomic dysregulation is highly unlikely to be caused by mutations in the exons of the HCRTR1 gene. PMID:26555080
  7. This study determined structures of OX1R bound to the OX1R-selective antagonist SB-674042 and the dual antagonist suvorexant at 2.8-A and 2.75-A resolution. PMID:26950369
  8. the orexinA/OX1 receptor axis has a significant pro-survival function in adrenal cells. PMID:26459696
  9. OX1R signaling can attenuate KOR-mediated reduction of cellular cAMP levels while enhancing KOR-mediated beta-arrestin recruitment and p38 activation. PMID:25857454
  10. OX1R and KOR heterodimerize, and this heterodimer associates with Galphas, leading to increased protein kinase A (PKA) signaling pathway activity, including upregulation of intracellular cAMP levels. PMID:25866368
  11. No significant differences were found in the distribution of either genotypic or allelic frequencies between Alzheimer's disease cases and controls in the HCRTR1 polymorphisms. PMID:24969517
  12. Orexins modifiy orexin receptor gene expression and gonadotropin release from the anterior pituitary gland. PMID:24333629
  13. DQ B1 but not HLA-DR typing, TNF-alpha levels, HCRTR1 and HCRTR2 were higher in narcolepsy-cataplexy/schizophrenia patients. PMID:24268496
  14. The present data indicate that OX1R-driven apoptosis is overexpressed in androgeno-independent prostate cancer exhibiting a neuroendocrine differentiation opening a gate for novel therapies for these aggressive cancers which are incurable until now. PMID:24910418
  15. Both orexin receptor subtypes, OX1R and OX2R, and CB1 cannabinoid receptors are capable of forming constitutive homo- and heteromeric complexes. PMID:24530395
  16. [review] Native orexin peptides consist of receptor agonists, orexin-A (33 amino acids) and orexin-B (28 amino acids) (aka hypocretin-1 and hypocretin-2). PMID:23034387
  17. Orexin receptors generate potent endocannabinoid signals in addition to arachidonic acid signals, which may explain the proposed orexin-cannabinoid interactions. PMID:22550093
  18. decreased ventilatory responses to hypoxia in human narcolepsy-cataplexy is in relation to HLA-DQB1*0602 status, not hypocretin deficiency PMID:21318258
  19. Intramolecular fluorescence resonance energy transfer (FRET) sensors of the orexin OX1 and OX2 receptors identify slow kinetics of agonist activation. PMID:22389503
  20. HCRTR1 gene could represent a genetic susceptibility factor for migraine without aura; the hypocretin system may have a role in the pathophysiology of migraine. PMID:21344296
  21. The Ile408Val polymorphism in the hypocretin receptor 1 (HCRTR1) gene and the Val308Iso (G1246A) polymorphism in the hypocretin receptor 2 (HCRTR2) gene in a sample of 215 panic disorder patients and 454 controls, were analyzed. PMID:21666548
  22. Data show that the HCRTR1 gene or a linked locus may modulate the risk for Major Mood Disorders and supports recent studies suggesting an involvement of hypocretin neurotransmitter system in affective disorders. PMID:21071097
  23. Results show that the N-terminal regions of orexin receptor are most important, and the exchange of the area from the C-terminal part of the transmembrane helix 2 to the transmembrane helix 4 is enough to lead to a change of the receptor's ligand profile. PMID:21510948
  24. analysis of orexin receptor 1 and 2 -arrestin-ubiquitin complexes PMID:21378163
  25. In differentiated IMR-32 neuroblastoma cells orexin/hypocretin and bradykinin receptors activate TRPC3/6 channels. PMID:20728215
  26. Data demonstrate the functional role of protein kinase D1 and protein kinase D3 in modulating physiological responses to Ox1R activation. PMID:20621130
  27. OX1 orexin receptor activation results in robust arachidonic acid release. PMID:20002100
  28. It was shown here that another motif, immunoreceptor tyrosine-based switch motif, is present in orexin receptor-1 (OX1R) and is mandatory for OX1R-mediated apoptosis. PMID:19661287
  29. The SK-N-MC cell line expresses an orexin binding site different from recombinant orexin 1-type receptor. PMID:11856342
  30. evidence that CB1 is able to potentiate an orexigenic receptor, OX1R PMID:12690115
  31. both OX1R and OX2R are expressed in the testis, epididymis, penis, and seminal vesicle PMID:15070969
  32. OX(1) receptors stimulate adenylyl cyclase via a low potency G(s) coupling and a high potency phospholipase C --> PKC coupling. PMID:15611118
  33. All adrenal corttex adenomas expressed OX1-R and OX2-R mRNAs, and real-time PCR showed that the expression of both receptors was up-regulated in adenomas PMID:15797953
  34. Our preliminary data suggest that mutation hcrtr1 might have an increased susceptibility to polydipsia through an undetermined mechanism. PMID:15978554
  35. Orexins act exclusively through OX1-receptors coupled to the adenylate cyclase/protein kinase A-dependent signaling cascade. PMID:16157481
  36. OX1 orexin/hcrtr-1 hypocretin receptors induce caspase-dependent and -independent cell death through p38 mitogen-/stress-activated protein kinase PMID:16282319
  37. This is the first demonstration of loss of Hcrt/Orx neurons in MSA, which is consistent with a system degeneration of neurons involved in homeostatic function, including sleep and autonomic regulation, in this disorder. PMID:17089135
  38. Results support the hypothesis that the HCRTR1 Ile408Val polymorphism may confer susceptibility to polydipsia in schizophrenia. PMID:17999203
  39. orexin-induced apoptosis is driven by an immunoreceptor tyrosine-based inhibitory motif (ITIM) present in the OX1R and is mediated by SHP-2 phosphatase recruitment via a mechanism that requires Gq protein but is independent of phospholipase C activation. PMID:18198212
  40. Both sporadic narcoleptic dogs and human narcolepsy-cataplexy subjects showed a significant decrease in hcrtR1 expression, while declines in hcrtR2 expression were not significant in these cases. PMID:18714784
  41. Induction of intracellular calcium signaling in isolated duodenal enterocytes is mediated primarily by OX1R receptors PMID:19118115
  42. OX1R are able to activate TRPC(3)-channel-dependent oscillatory responses independently of store discharge. PMID:19464259

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links

HGNC: 4848

UNIGENE: Hs.388226

KEGG: hsa:3061

STRING: 9606.ENSP00000362810

OMIM: 602392

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1