METNFSIPLNETEEVLPEPAGHTVLWIFSLLVHGVTFVFGVLGNGLVIWVAGFRMTRTVN TICYLNLALADFSFSAILPFRMVSVAMREKWPFGSFLCKLVHVMIDINLFVSVYLITIIA LDRCICVLHPAWAQNHRTMSLAKRVMTGLWIFTIVLTLPNFIFWTTISTTNGDTYCIFNF AFWGDTAVERLNVFITMAKVFLILHFIIGFSVPMSIITVCYGIIAAKIHRNHMIKSSRPL RVFAAVVASFFICWFPYELIGILMAVWLKEMLLNGKYKIILVLINPTSSLAFFNSCLNPI LYVFMGRNFQERLIRSLPTSLERALTEVPDSAQTSNTDTTSASPPEETELQAM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Acts as a receptor for humanin.
Gene References into Functions
The demonstrated proper folding and functionality of the cell-free produced human FPR3 opens a new avenue for the fast and efficient generation of human FPRs (and even other GPCRs) for structural and functional analysis.PMID:23746112
transcriptional variations of FPR3 occur by an alternative promoter during primate evolution.PMID:21717223
F2L peptide, derived from the processing of nanomolar concentrations of heme-binding protein (HEBP)1, is active on FPR3 and able to induce recruitment of FPR3-expressing monocytes, macrophages, and mouse neutrophilsPMID:21709160
Results show that uPAR expression regulates the adhesive and migratory ability of CXCR4-expressing cells through a mechanism involving fMLP receptors and alpha-v integrins.PMID:20972812
Human dendritic cells express functional FPRL2 throughout maturation. FPRL2 & its endogenous ligand may be involved in regulating DC trafficking during Ag uptake & processing s well as the T-cell-stimulating phase of the immune responses.PMID:12223529
Activation of FPRL2 inhibits lipopolysaccharide-induced dendritic cell maturation.PMID:16002663
However, F2L inhibits formyl peptide receptor (FPR) and FPRL1 activities, resulting in the inhibition of intracellular calcium increases, and superoxide generation induced by N-formyl-Met-Leu-Phe, MMK-1, or Trp-Lys-Tyr-Met-Val-d-Met in neutrophils.PMID:17577578
FPRL2 is expressed and functional in macrophages differentiated from monocytes in vitro in different conditionsPMID:19342677
Human monocytes express FPR1, FPR2, and FPR3; human neutrophils express FPR1 and FPR2, but not FPR3.PMID:19843937
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in various tissues with highest expression in lung.