Recombinant Human Mitochondrial brown fat uncoupling protein 1 (UCP1)

Code: CSB-CF025554HU
Size:
20μg
20μg100μg
US$4792
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: 10xHis-SUMO-tag
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
UCP1
Uniprot NO.
Alternative Names
mitochondrial brown fat uncoupling protein; Mitochondrial brown fat uncoupling protein 1; SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP 1; UCP; UCP1; UCP1_HUMAN; uncoupling protein 1 (mitochondrial, proton carrier); Uncoupling protein 1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-307
Target Protein Sequence
MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLG TITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAG LTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPN LMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR QTMDCAT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Mitochondrial protein responsible for thermogenic respiration, a specialized capacity of brown adipose tissue and beige fat that participates in non-shivering adaptive thermogenesis to temperature and diet variations and more generally to the regulation of energy balance. Functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane. However, LCFAs remaining associated with the transporter via their hydrophobic tails, it results in an apparent transport of protons activated by LCFAs. Thereby, dissipates the mitochondrial proton gradient and converts the energy of substrate oxydation into heat instead of ATP. Regulates the production of reactive oxygen species/ROS by mitochondria.
Gene References into Functions
  1. Results suggest that G-quadruplex structure is a potential target to regulate the expression of uncoupling protein 1 (UCP1). PMID:29796650
  2. Cellular and genetic evidence supported the regulation of UCP1 transcription by IRX3 as a direct mechanism on the browning program of white adipocytes. PMID:28988979
  3. Multiple regression analysis showed that age, male gender, body max index, presence of obesity, type-2-diabetes mellitus, hypertension and coronary artery disease and left ventricular ejection fraction were associated with the expression levels of UCP1, PGC1alpha and PRDM16 mRNA PMID:28824327
  4. Results found a specific fatty acids binding site that is functionally important to the H+ transport activity of UCP1-mediated flux. PMID:28781081
  5. MKK6 acts as a repressor of UCP1 expression, suggesting that its inhibition promotes adipose tissue browning and increases organismal energy expenditure. PMID:29021624
  6. determined transcriptional levels of UCP1 and UCP2 in peripheral blood mononuclear cells (PBMCs) from patients with metabolic disorders: type 2 diabetes, obesity and from healthy individuals. PMID:29151065
  7. We observed that clozapine but not six other antipsychotic drugs reprogrammed the gene expression pattern of differentiating human adipocytes ex vivo, leading to an elevated expression of the browning marker gene UCP1, more and smaller lipid droplets and more mitochondrial DNA than in the untreated white adipocytes. PMID:27898069
  8. The GG genotype of the UCP1-3826 A/G polymorphism appears to contribute to the onset of childhood obesity in Turkish children. The GG genotype of UCP1, together with the del/del genotype of the UCP2 polymorphism, may increase the risk of obesity with synergistic effects. The ins allele of the UCP2 exon 8 del/ins polymorphism may contribute to low HDL cholesterolemia. PMID:28704105
  9. TENM2 knockdown induces both UCP1 mRNA and protein expression upon adipogenic differentiation without affecting mitochondrial mass. PMID:28088466
  10. The role of UCP1 gene polymorphisms A-3826G, A-1766G, Met229Leu and Ala64Thr in susceptibility to obesity or metabolic syndrome was reviewed. PMID:28100847
  11. Haplotype-based interaction between the PPARGC1A and UCP1 genes is associated with impaired fasting glucose (IFG) or type 2 diabetes mellitus (T2DM) among the residents of Henan province, China. Individuals with the haplotype AAG (PPARGC1A gene) and CTCG (UCP1 gene) have increased susceptibility to IFG or T2DM, while those with haplotype AAG (PPARGC1A gene) and CTCA (UCP1 gene) have a lower risk of IFG or T2DM. PMID:28591028
  12. human and rodent Brown adipose tissue have similar UCP1 function per mitochondrion. PMID:27508873
  13. glucocorticoids increased isoprenaline-stimulated respiration and UCP-1 in human primary brown adipocytes. PMID:27411014
  14. These results reveal different characteristics in the biological actions between WAT and BAT in obese humans. Increased levels of IL6, UCP1 and SIRT1 in the BAT were associated with metabolic parameters improvements. PMID:28073126
  15. UCP1 dietary activation can alleviate obesity. (Review) PMID:28057582
  16. The molecular features of UCP1 support a conventional mitochondrial carrier-like mechanism. (Review) PMID:28057583
  17. The history of discovery of UCP1, the mitochondrial uncoupling protein of brown adipocyte, has been described. (Review) PMID:27916641
  18. Transcriptional regulation of the UCP1 protein in obesity and normal thermogenesis has been described. (Review) PMID:27693079
  19. The H+ transport mediated by UCP1 was shown to be electrophoretic with a linear relation to the membrane potential. (Review) PMID:27794497
  20. In the absence of purine nucleotides, UCP1 presents a high ohmic proton conductance that does not require the presence of activating ligands, such as fatty acids or retinoids. PMID:27750036
  21. UCP1 is a transporter for H(+) and fatty acid anions. (Review) PMID:27984203
  22. In inguinal white adipose tissue (iWAT) of mice fed a high-fat diet (HFD), Ucp1 level decreases concomitantly with increases in Cnot7 and its interacting partner Tob. PMID:26711342
  23. Findings suggest that polymorphisms in SIRT6/UCP1 genes may be important for increased carotid plaque burden and echodensity PMID:26332421
  24. UCP1 -3826 A>G polymorphism is associated with weight, body fat mass, and risk of type 2 diabetes mellitus in obese individuals candidates for bariatric surgery. PMID:26458326
  25. UCP1 and UCP3 expression is associated with lipid and carbohydrate oxidation in patients submitted to bariatric surgery. PMID:26959981
  26. 1-3826 A>G polymorphism associated with elevated lipid and apolipoprotein levels in Chinese population PMID:25928572
  27. this study reveals that human adipose-derived stromal/progenitor cells can be readily differentiated into beige adipocytes that, upon activation, undergo uncoupling protein 1-dependent thermogenesis. PMID:25389910
  28. This study suggests that the SNP rs1800592 in the UCP1 gene is associated with increased risk of PDR in the Chinese type 2 diabetes mellitus population. PMID:25274455
  29. Genotype and allele distributions of UCP1, UCP2 and UCP3 polymorphisms did not differ significantly between obese and non-obese Type 2 Diabetes Mellitus patients.[Meta-analysis] PMID:24752406
  30. Uncoupling protein 1 binds one nucleotide per monomer and is stabilized by tightly bound cardiolipin. PMID:26038550
  31. Meta-analysis. There was no significant association of the UCP1-3826A/G polymorphism with BMI mean differences. PMID:24804925
  32. By the application of these findings, we demonstrate that UCP1 is functionally thermogenic in intact brite adipocytes and adrenergic UCP1 activation is largely dependent on adipose triglyceride lipase (ATGL) rather than hormone sensitive lipase (HSL). PMID:25135951
  33. BMI and TBF were significantly different among UCPI -3826A/G and UCP3 -55C/T genotype combinations, suggesting the existence of a gene interaction between UCP1 and UCP3 in influencing obesity and adiposity in multiethnic Malaysians. PMID:25812254
  34. MED1 is required for optimal PRDM16-induced Ucp1 expression PMID:25644605
  35. In obesity, in vitro differentiated beige/brite adipocytes derived from preadipocytes of human subcutaneous white adipose tissues express less UCP1. PMID:24642703
  36. Human white adipocytes express the cold receptor TRPM8 which activation induces UCP1 expression, mitochondrial activation and heat production. PMID:24342393
  37. UCP1 -3826A/G and ADRB3 Trp64Arg polymorphisms may have a combined effect in the modulation of overweight/obesity and HDL-C levels in type 2 diabetes mellitus (T2DM) Caucasian-Brazilian patients PMID:24138564
  38. The season-specific effects of UCP1 on visceral fat area were consistent with a previous finding that active brown adipose tissue was more frequently found in winter than in summer. PMID:24086366
  39. All-trans-retinoic acid (ATRA) induces UCP1 expression in mouse adipocytes through activation of RARs, whereas expression of UCP1 in human adipocytes is not increased by exposure to ATRA. PMID:24059847
  40. VDR directly inhibits the expression of uncoupling protein-1 (UCP1). PMID:23906633
  41. UCP1 -3826 A/G substitution accelerates age-related decrease in BAT activity, and thereby may associate with visceral fat accumulation with age. PMID:23032405
  42. UCP1 can exist in different functional monomeric and associated states. PMID:24196960
  43. UCP-1 is relatively abundant in epicardial fat, and this depot possesses molecular features characteristic of those found in vitro in beige lineage adipocytes. PMID:23824424
  44. Compares and contrasts all the known human SLC25A* genes and includes functional information. PMID:23266187
  45. High UCP1 expression is associated with pheochromocytoma. PMID:23454374
  46. UCP-1 single nucleotide polymorphism A-3826G is associated with the dampness-phlegm pattern in Korean stroke patients. PMID:23043591
  47. The present study demonstrates a sex-specific effect of genetic variants in UCP1 and SIRT3 on cIMT PMID:22750084
  48. UCP1 in HEK293 cell mitochondria is fully inhibitable and does not contribute to basal proton conductance. PMID:22676960
  49. These data are consistent with FTO rs9939609 and UCP-1 rs6536991 common variants as contributors to obesity in the Brazilian population. PMID:23134754
  50. This study links the GG homozygous form of UCP1 with obesity and blood pressure among females only. PMID:22764640

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Brown adipose tissue.
Database Links

HGNC: 12517

UNIGENE: Hs.249211

KEGG: hsa:7350

STRING: 9606.ENSP00000262999

OMIM: 113730

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products