MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture.
Gene References into Functions
Novel sequence variants in the LIPH and LPAR6 genes underlies autosomal recessive woolly hair/hypotrichosis in three consanguineous Pakistani families.PMID:28425126
DLD-C-F cells formed large-sized colonies, but not DLD-F-C cells, correlating with LPAR1 and LPAR6 gene expression levels. These results suggest that LPA1 and LPA6 may regulate the colony formation activity in DLD1 cells treated with anticancer drugs.PMID:29369010
LPA2 mRNA levels were associated with poorer differentiation, and higher LPA6 levels were associated with microvascular invasion in HCC; both became a risk factor for recurrence after surgical treatment when combined with increased serum ATX levelsPMID:27583415
LPAR6 has a role in tumorigenicity of hepatocellular carcinomaPMID:25589345
These results suggest that the diverse roles of LPA4, LPA5 and LPA6 are involved in the activation of tumor progression in pancreatic cancer cells.PMID:25849892
Missense mutations in LPAR6 reveal abnormal phospholipid signaling pathways leading to hypotrichosis.PMID:25119526
We have identified a novel deletion mutation in LPAR6, which was responsible for autosomal woolly hair syndrome with hypotrichosis in a consanguineous Chinese family.PMID:23773027
study extends the spectrum of mutations in LPAR6/P2RY5 gene and underscores those mutations in LPAR6/P2RY5 and LIPH result in similar phenotypesPMID:22385360
LPA2 and LPA6 receptor subtypes are predominant in both HPAECs and HMVECsPMID:23084965
These findings extend the spectrum of known LPAR6 mutations and suggest a founder effect of the p.G146R mutation in the Pakistani populationPMID:22531990
homozygous loss of the entire LPAR6 gene in a Turkish family with hypotrichosis and woolly hairPMID:22621192
Mutations identified in the present study extend the body of evidence implicating LPAR6 and LIPH genes in pathogenesis of human hereditary hair loss.PMID:21426374
Autosomal recessive form of hypotrichosis simplex mapped to chromosome 13q14.11-13q21.33, and identified homozygous truncating mutations in P2RY5.PMID:18297070
Disruption of P2RY5, an orphan G protein-coupled receptor, underlies autosomal recessive woolly hair.PMID:18297072
In the present study, 14 of 22 families with autosomal recessive hypotrichosis show linkage to LAH3 locus on chromosome 13q14.11-q21.32. Affected individuals of all the 22 families have common clinical features.PMID:18461368
Our findings show that mutations in P2RY5 display variable expressivity, underlying both hypotrichosis and woolly hair, and underscore the essential role of P2RY5 in the tissue integrity and maintenance of the hair follicle.PMID:18692127
There is an involvement of P2RY5 mutations in hereditary hair diseases.PMID:18803659
LIPH is a second causative gene for ARWH/hypotrichosis, giving rise to a phenotype clinically indistinguishable from P2RY5 mutationsPMID:18830268
gene is involved in genetics of hypotrichosis simplex and autosomal recessive wooly hair syndrome.PMID:19061667
Mutations revealed in the results extend the body of evidence implicating the P2RY5 gene in the pathogenesis of human hereditary hair loss.PMID:19292720
study increases the spectrum of known P2RY5 mutations and highlights the importance of this receptor in human hair growth and texturePMID:19529952
Expression of turkey (Meleagris gallopavo) 6H1/p2y5 receptor in human astrocytoma cells and measurement of second mesenger levels indicate it is not a member of the P2Y receptor family.PMID:9240460
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed ubiquitously, including in skin and hair follicle cells. Detected in both Henle's and Huxley's layers of the inner root sheath of the hair follicle and in suprabasal layers of the epidermis (at protein level). Expressed at low levels in peripher