FCGR2A; CD32; FCG2; FCGR2A1; IGFR2; Low affinity immunoglobulin gamma Fc region receptor II-a; IgG Fc receptor II-a; CDw32; Fc-gamma RII-a; Fc-gamma-RIIa; FcRII-a; CD antigen CD32
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
34-317
Target Protein Sequence
QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens.
Gene References into Functions
The results demonstrate that CD32 expression is a marker of CD4+ T cell activation in HIV+ individuals.PMID:30013105
this study shows that genetic variation of human neutrophil Fcgamma receptors and SIRPalpha in antibody-dependent cellular cytotoxicity towards cancer cellsPMID:28952147
this study shows that FCGR genetic polymorphism affects antibody responses to GARP in patients with breast cancerPMID:29879453
Data indicate that the Fc gamma receptor FCgammaRIIA polymorphisms did not significantly influence response to rituximab in immune thrombocytopenic purpura (ITP).PMID:28856973
Results showed significantly higher frequency of FC gamma receptor FCGR3A-158V allele in patients with immune thrombocytopenia (ITP) compared with control subjects, but not significant differences in the genotype distribution or allele frequencies for FC gamma receptor FCGR2A-131H/R between patients and controls.PMID:28942727
Differently oxidized isolated subspecies can lead both to stronger as well as weaker binding and activation of the histidine variant of Fc fragment of IgG receptor IIa (FcgammaRIIa).PMID:28988621
CRP bound to surface CD32 (also known as FcgammaRII) on myeloma cells, which activated a pathway mediated by the kinase p38 MAPK and the transcription factor Twist that enhanced the cells' secretion of osteolytic cytokines.PMID:29233917
FCGR2A single nucleotide polymorphism confers susceptibility to idiopathic nephrotic syndromePMID:29155175
alphaIIb beta3 antagonist TMV-7/trimucrin prevents thrombosis with causing Fc receptor gamma-chain IIa-mediated thrombocytopenia.PMID:28815933
The expression levels of human FcgammaRIIB but not FcgammaRIIA were negatively correlated with serum levels of IgE in human asthma patients.PMID:29597194
When higher-affinity genotypes for FCGR2A, FCGR3A, and FCGR2C were considered together, they were associated with significantly increased tumor shrinkage and prolonged survival in response to HD-IL2... this is the first study to show associations of FCGR genotypes with outcome following HD-IL2 treatmentPMID:27742794
FcgammaRIIA and FcgammaRIIB both demonstrated increased methylation levels in Kawasaki disease (KD) patients that underwent IVIG treatment. FcgammaRIIA expression influenced the IVIG treatment response of KD patients. The FcgammaRIIA/IIB mRNA expression ratio was greater in KD patients with coronary artery lesion formation.PMID:27893416
FCGR2A rs1801274 G-allele confers susceptibility to Kawasaki disease and Ulcerative colitisPMID:27270653
farletuzumab has enhanced binding to FCGR3A-158V high-affinity receptor and has an enhanced clinical outcome in ovarian cancer patients with low baseline CA125 levels and at least 1 high-affinity allele of FCGR2A or FCGR3APMID:29041009
inhibition of Abl/Src with bosutinib reduced FcgammaRIIA-mediated glomerular neutrophil accumulation and renal injury in experimental, crescentic anti-GBM nephritis.PMID:28891817
The present study demonstrates that p.His167Arg, a KD-associated FCGR2A variant, acts as a susceptibility gene in males only. Overall, the gender differences associated with FCGR2A in KD provide a new insight into KD susceptibility.PMID:28886140
Data indicate a mechanism in which Toll-like receptors TLR7/8 signaling, through shedding of FcgRIIA, shifts neutrophil function from phagocytosis to a programmed necrosis pathway, neutrophil extracellular trap formation (NETosis).PMID:28606989
Gene copy number variation (CNV) of the PKLR, FCGR2A, FCGR2C, and FCGR3 genes is associated with malaria severity, and our results provide evidence for a role of CNV in host responses to malaria.PMID:28605553
This study demonstrated that no association between FCGR2A polymorphisms in Guillain-Barre Syndrome in a Brazilian population.PMID:27609290
FCGR3A V and FCGR2A R allele carriers show better responsiveness to anti-TNF-alpha therapy--{REVIEW}PMID:27490376
Association between Fc gamma receptor IIA genetic polymorphisms and susceptibility to severe malaria anemia in children in western Kenya.PMID:28427365
identification of a subpopulation of 0.012% of CD4 T cells that express CD32a and host up to three copies of HIV DNA per cell; this CD32a(+) reservoir was highly enriched in inducible replication-competent proviruses and can be predominant in some participants; that CD32a(+) lymphocytes represent the elusive HIV-1 reservoir may lead to insights that will facilitate the specific targeting and elimination of this reservoirPMID:28297712
Single nucleotide polymorphisms (SNPs) rs2099684 in IgG receptors FCGR2A/FCGR3A can be considered a genetic risk factor for Takayasu arteritis (TA) in the Chinese Han population.PMID:27769046
The mutant homozygote (CC) of the FCGR2A gene (rs1801274) may have a protective role among Chinese patients with UC.PMID:27984611
Review/Meta-analysis: FcgammaRIIa-H131R may modify treatment rituximab response in diffuse large B cell lymphoma.PMID:28039707
FCGR2A and FCGR2C polymorphisms may also contribute to immunocomplexemia present in sarcoidosis.PMID:26801149
The absence of TULA-2 and also the relative level of TULA-2 expression modulates FcgammaRIIA-mediated platelet reactivity and heparin-induced thrombocytopenia in vivo.PMID:27765766
FCGR2A expression is significantly upregulated in human masticatory mucosa during wound healingPMID:28005267
Review/Meta-analysis: Rheumatoid arthritis patients with FCGR2A HH + HR genotype show a poor response to adalimumab.PMID:27074847
Our findings indicate that CD16 158F>V polymorphism may contribute to the increased risk of Idiopathic Thrombocytopenic Purpura, whereas CD32 131H>R polymorphism may not be an important risk factor for Idiopathic Thrombocytopenic Purpura.PMID:27315784
Our observations support the existence of a central FcgammaRIIA-mediated pathway by which human platelets respond to both Gram-negative and Gram-positive bacteria.PMID:27025455
FcgammaRIIA H131 allele and FcgammaRIIA H/H131 genotype were significantly increased in pediatric Guillain-Barre syndrome patients.PMID:27064330
FCGR2A/FCGR3A-related immune disorder might contribute to the etiology of Takayasu arteritis.PMID:26996483
Data indicate no significant difference in the allele or genotype frequencies of the Fcgamma2RA protein (FCGR2A) rs1801274 single nucleotide polymorphism was observed between groups.PMID:27267995
The RR, HR, and HH FCGR2A-131 genotypes were detected in 1 (11 %), 5 (56 %), and 3 (33 %) of patients with disease relapse compared to 25 (21 %), 56 (47 %), and 38 (32 %) of the 119 patients without relapse.PMID:27376362
The data indicate that FcgammaRIIA genotyping can be used as a marker of genetic susceptibility to sepsis.PMID:26490967
FCGR3A and FCGR2A SNPs do not confer differential responsiveness to rituximab.PMID:26510856
Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.PMID:26748351
R/R genotype of FCGR2A p.R131H and G/G genotype of CCL2 c.-2518 A > G polymorphisms are associated with thrombocytopenia, which is a characteristic laboratory finding in dengue infections.PMID:26429304
Genetic variants of rs6671847 at FCGR2A and rs17085007 at 13q12 conferred a risk of relapse in patients with ulcerative colitis.PMID:25787843
we fail to find the significant association between FCGR2A H131R and clinical outcome in KRAS wild metastatic colorectal cancer individuals with adjuvant cetuximab therapyPMID:26363448
The results show an association between FcgRIIa, TNF-alpha and IL-6 gene single nucleotide polymorphisms and symptom persistence in Dengue patients.PMID:26429310
FCGR2A polymorphisms constitute a risk factor for graft loss following kidney transplantation and that this effect is related to anti-HLA antibodies.PMID:26429312
FcgammaRIIIA/FcgammaRIIA gene polymorphisms and HER-2 may have a role in antibody-dependent cellular cytotoxicity and clinical response to trastuzumab in breast cancerPMID:26450443
The goal of the study was the development of a novel method for Y402H (g.43097C>T) genotyping, the confirmation of its association with AMD in the Greek population and the investigation of the H131R polymorphism in AMDPMID:25811666
These include an FCGR2A/2C chimeric gene that causes a decreased expressionPMID:26133275
Genetic variation Fc gamma receptor IIA may contribute to infectious susceptibility in trauma patients.PMID:26496101
this meta-analysis suggested that the H131R polymorphism in the FCGR2A gene might be associated with susceptibility to KD in Asians.PMID:26125827
study found homozygous carriers of the FcgammaRIIA-131R/R allele had higher malaria-specific antibody levels compared to heterozygous carriers of FcgammaRIIA-131R/H alleles and to homozygous carriers of FcgammaRIIA-131H/H alleles; the pre-existing antibody responses were related to reduced subsequent risk of clinical malariaPMID:25447268
Review: discuss role of human FCGR2A in immune processes and thrombosis.PMID:25900780
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Found on monocytes, neutrophils and eosinophil platelets.