Abbreviation
Recombinant Human FCGR2A protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human FCGR2A at 2 μg/mL can bind Anti-FCGR2A recombinant antibody (CSB-RA008540MA1HU). The EC50 is 24.44-32.57 ng/mL.
Alternative Names
Low affinity immunoglobulin gamma Fc region receptor II-a; IgG Fc receptor II-a; CDw32; Fc-gamma RII-a (Fc-gamma-RIIa; FcRII-a); CD32; FCGR2A; CD32, FCG2, FCGR2A1, IGFR2
Species
Homo sapiens (Human)
Expression Region
34-217aa
Target Protein Sequence
QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human FCGR2A at 2 μg/ml can bind Anti-FCGR2A recombinant antibody (CSB-RA008540MA1HU). The EC50 is 24.44-32.57 ng/mL.
-
The purity of FCGR2A was greater than 90% as determined by SEC-HPLC
Description
FCGR2A mediates antibody-dependent cellular phagocytosis and cytotoxicity by binding the Fc region of IgG, making it a critical node in immune effector function and a key target for therapeutic antibody engineering. This mammalian-expressed construct spanning residues 34–217 captures the complete extracellular ligand-binding domain, and its native glycosylation pattern supports physiologically relevant interactions with IgG and anti-FCGR2A antibodies, as demonstrated by an EC50 of 24.44–32.57 ng/mL in functional ELISA. The protein meets the quality thresholds commonly required for ligand-binding assays, competitive inhibition screening, and therapeutic antibody epitope mapping, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg. Researchers conducting SPR or BLI affinity characterization, blocking antibody validation, or ADCC mechanism studies will find this construct provides a suitable basis for quantitative receptor-ligand interaction analysis.
