WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia.
Gene References into Functions
L-selectin (CD62L) has been identified as an HIV-1 adhesion receptor on CD4+ T cells.PMID:30026537
PI3K is a signal linker between L-selectin and PSGL-1 in IL-18 transcriptional activation at the promoter level.PMID:29218606
SELL expression was not altered in systemic sclerosis.PMID:29356883
Dual regulation of CD62L by HIV-1 via enhanced expression by Vpr in contrast with cell-surface down-modulation by Nef and Vpu has been reported.PMID:30119013
Recombinant human IL33 inhibited trophoblast invasion and adhesion, and decreased adhesion and invasionassociated molecules such as integrin alpha4beta1 and CD62L.PMID:28765940
CD62L has merit for risk stratification in natalizumab treatment is associated with progressive multifocal leukoencephalopathy.PMID:26432858
sLe(x) expressed on human L-selectin is preferentially bound by E-selectin and, on ligation, initiates secretion of MRP8/14 that binds TLR4 to elicit the extension of beta2-integrin to an intermediate affinity state.PMID:28811304
Here, we further developed and applied this method to express and purify the entire extracellular region of CD62L. This resulted in excess of 20 mg/L yield of recombinant CD62L. In an attempt to understand the different expression levels among four similar CD62L constructs that differ primarily in signal sequences, we calculated the presence of potential RNA pseudoknots in their signal sequencesPMID:28842197
identified CD62L as a marker of a distinct NKT subset endowed with high proliferative potential and have developed artificial antigen-presenting cells that generate CD62L-enriched NKTs for effective cancer immunotherapyPMID:27183388
The -642C>T and 725C>T SELL polymorphisms are protective factors against acute coronary syndrome. SELL gene expression was increased in ACS patients.PMID:28478085
CD62L downregulation due to unconstrained HIV-1 replication may have important consequences for T-cell circulation and function and for HIV-1 disease progressionPMID:27003497
found a higher frequency of LIN1(-) CCR3(+) eosinophils, and decreased expression of CD23 and CD62L receptors in eosinophils of AD patientsPMID:27406841
Indian patients with primary Sjogren's syndrome have higher salivary sL-selectin and IL-7 levels than healthy controlsPMID:27620619
While total surface expression of CD11b and L-selectin on neutrophils was largely unaffectedPMID:26361072
These data confirm the expression of CD62L on urothelial carcinoma cells and suggest that CD62L may serve as biomarker to predict the presence of or risk for developing metastatic disease in patients with bladder cancer.PMID:25618296
freeze and thaw of murine and human Tregs is associated with reduced expression of L-selectin (CD62L), which was previously established to be an important factor that contributes to the in vivo protective effects of TregsPMID:26693907
Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine BacteriaPMID:26852488
Here we report that HIV-1 down-modulates CD62L in productively infected naive and memory resting CD4 T cells while suppressing Foxo1 activity and the expression of KLF2 mRNA.PMID:25330112
the polymorphisms within L-selectins gene were not associated with Visceral leishmaniasis and it may be concluded that these genotypes and alleles are unable to affect immune responses in Visceral leishmaniasis patientsPMID:25209910
Functional analyses revealed that the lymphocyte homing receptor L-selectin (CD62L) is the key factor controlling the binding of chronic lymphocytic leukemia cells to high endothelial venule walls in vivo.PMID:26162407
SELL rs7531806 and rs1060573 are involved in androgen metabolism, inflammation processes and scar formation in severe acne.PMID:24399259
Both Nef and Vpu associated with and sequestered CD62L in perinuclear compartments, thereby impeding CD62L transport to the plasma membrane.PMID:25822027
Variants within the SELL gene are associated with sL-selectin levels. Despite accounting for a significant portion of the protein level variance, none of the variants was associated with clinical or subclinical cardiovascular disease.PMID:25576479
P-selectin glycoprotein ligand-1 and L-selectin have roles in neutrophil recruitment and activate human endothelial colony-forming cells at the site of vessel injuryPMID:24606340
Increased expression of L-selectin ligands may be involved in the implantation process in tubal pregnancy.PMID:24829027
A cellular model system for quantifying L-selectin adhesion mechanics, is described.PMID:23927766
Individuals who undertake physical activity regularly, benefit from each single physical effort, because of decrease in serum concentration of proinflammatory molecules such as L-selectin and P-selectin.PMID:25095634
in a large, multiethnic population, soluble L-selectin levels did not predict clinical or subclinical cardiovascular diseasePMID:24631064
results indicate a regulatory influence of MR signaling on human T-cell migration and suggest a role for endogenous aldosterone in the redistribution of T-cell subsets to lymph nodes, involving CD62L, CCR7, and CXCR4.PMID:24595810
the association between expression of the adhesion molecule CD62L (L-selectin) on naive and central memory T cells and the formation of antigen-specific antibodies differed significantly between younger and elder donors.PMID:23571167
The PSGL-1-L-selectin complex-induced signaling effects on neutrophil slow rolling and recruitment in vivo demonstrate the functional importance of this pathway.PMID:24127491
Molecular basis for the moesin/l-selectin/CaM ternary complex; an important role for phospholipids in modulating l-selectin function and shedding.PMID:23796515
the association of calmodulin with L-selectinPMID:23658780
Cell-based assessment of the percentage of L-selectin-expressing CD4 T cells could provide an urgently needed biomarker for individual risk assessment of progressive multifocal leukoencephalopathy (PML).PMID:23925765
Coronary artery disease patients blood samples showed a significantly higher L-selectin, but not CD11b response to TLR stimulation than controls.PMID:23573259
Over-activation of ADAM17 in NK cells may be detrimental to their effector functions by down-regulating surface expression of CD16 and CD62L.PMID:23487023
ATP induces CD62L downregulation from the surface of naive CD4+ T lymphocytes through the P2X7 receptor.PMID:23319734
association between L-selectin concentrations in plasma and skin damage in patients with systemic sclerosisPMID:23028631
Native glycodelin-A binds to peripheral blood monocytes inducing interleukin-6 secretion through L-selectin.PMID:22977256
determination of critical patch lengths of P-and L-selectin for the initiation of HL-60 cell binding in shear flowPMID:22627390
a unique lymphoid-primed population in human bone marrow was generated from hematopoietic stem cells before onset of expression of CD10 and commitment to the B cell lineage identified by high expression of the homing molecule L-selectin (CD62L).PMID:22941246
[review] Distinct domains of L-selectin contribute to proper leukocyte migration out of the vasculature into surrounding tissues during inflammation and immune surveillance.PMID:21546114
P213S polymorphism of the L-selectin gene is associated with type 2 diabetes and insulin resistance.PMID:22921892
Pretreatment of cardiac mesoangioblasts with SDF-1 or transient expression of L-selectin induced a two- to three-fold increase in their transmigration and homing to the damaged heart.PMID:21869829
No statistically significant results were found in order to sustain the hypothesis of association between SELL gene P213S polymorphism, type 2 diabetes mellitus and end stage renal disease.PMID:22119815
Levels of P-selectin and L-selectin were decreased in AD and lowest in AD patients with highest cognitive decline. Our findings suggest that these molecules may induce alterations of endothelial regulation and influence neurodegenerative processes of ADPMID:21484243
Lower frequency of CD62L(high) and higher frequency of TNFR2(+) Tregs are associated with inflammatory conditions in type 1 diabetic patients.PMID:21584225
L-selectin gene may play a role in the development of ischemic stroke.PMID:21465128
These results suggest that the association of CaM with L-selectin in the cell can be influenced by the membrane bilayer and that anionic lipids may modulate ectodomain shedding of transmembrane receptors.PMID:21664913
Data show that L-selectin TM and cytoplasmic domains lack the ability to dimerize in cell membranes.PMID:21316337
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.