Home
Product
Protein
Transmembrane Proteins
Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2)

Recombinant Human Killer cell immunoglobulin-like receptor 3DL2 (KIR3DL2)

Code: CSB-CF012365HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5742

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

KIR3DL2

Uniprot NO.

P43630

Alternative Names

KIR3DL2; CD158K; NKAT4; Killer cell immunoglobulin-like receptor 3DL2; CD158 antigen-like family member K; MHC class I NK cell receptor; Natural killer-associated transcript 4; NKAT-4; p70 natural killer cell receptor clone CL-5; p70 NK receptor CL-5; CD antigen CD158k

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

22-455

Target Protein Sequence

LMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor on natural killer (NK) cells and T cells for MHC class I molecules. Upon binding of peptide-free HLA-F open conformer, negatively regulates NK and T cell effector functions. Acts as a receptor on astrocytes for HLA-F. Through interaction with HLA-F, may protect motor neurons from astrocyte-induced toxicity.

Gene References into Functions

We show that KIR3DL2 expression is the most sensitive diagnostic criterion of Sezary syndrome when compared with all other available biological criteria. KIR3DL2 therefore represents a valuable tool for routine use as a clinical parameter at diagnosis, for prognosis and during patient follow-up PMID:28119365
results identified significant KIR3DL2 expression in all cutaneous T-cell lymphomas subtypes PMID:29089310
Overexpression of a single MHCI molecule, HLA-F, protects human MNs from ALS astrocyte-mediated toxicity, whereas knockdown of its receptor, the killer cell immunoglobulin-like receptor KIR3DL2, on human astrocytes results in enhanced motor neurons death PMID:26928464
KIR-3DL2 binding to HLA-B27 licenses Th17 cell differentiation in spondyloarthritis. PMID:26841353
In early axial spondyloarthritis and ankylosing spondylitis Dutch patients, no copy number changes were found for KIR3DL2. PMID:25940819
we show that the allele KIR3DL2*001 and the single nucleotide polymorphism 1190T (rs3745902) are associated with differential susceptibility to pemphigus PMID:25867094
CD158k expression was identified on cutaneous CD4+ T cells in healthy individuals and also mycosis fungoides patients. PMID:25044837
These findings provide novel insights about the molecular basis of KIR3DL2 binding to B27 PMID:25582852
these data provide evidence for a possible role of KIR3DL2 in the maintenance of a high circulating malignant-cell burden by preventing activation-induced cell death. PMID:25414436
Our results indicate that KIR3DL2 can directly promote Sezary syndrome malignant cell death through the use of CpG ODN. PMID:25007046
our results show that a multistep gating of CD158k+ cells is reliable to assess tumor burden in case of Sezary syndrome. PMID:25158034
our results offer preclinical proof of concept for the clinical development of IPH4102, a humanized monoclonal antibody that targets the immune receptor KIR3DL2,to treat patients with nced cutaneous T-cell lymphoma PMID:25361998
KIR3DL2 binds to HLA-B27 dimers and free H chains more strongly than other HLA class I and promotes the expansion of T cells in ankylosing spondylitis. PMID:23440420
PLS3, Twist, KIR3DL2 and NKp46 gene expression can model efficient molecular Sezary syndrome diagnosis. PMID:23429988
most frequently expressed KIR receptor in transformed mycosis fungoides PMID:22621189
results suggest that carriers of A allele in exon 3 of killer cell immunoglobulin-like receptor 3DL2(KIR3DL2) have a decreased susceptibility to preeclampsia PMID:21406041
Enhanced proliferation, survival, and interleukin (IL)-17 production of KIR3DL2+ CD4 T cells stimulated with antigen-presenting cells expressing HLA-B27 homodimers suggest new therapeutic strategies in ankylosing spondylitis. PMID:21248258
Data show direct binding of KIR3DL2 to ODNs and we show that the D0 domain is involved primarily in this interaction. PMID:20147700
The A52G polymorphism in exon 3 and the frequencies of C32T in exon 9 of KIR3DL2 gene polymorphism are associated with the pathogenesis of pre-eclampsia. PMID:19953898
All genotypes seen included genes for KIR3DL2. PMID:12559621
IR3DL2/p140 engagement does not result into inhibitory (nor activatory) effects on tumor-specific cytotoxic T lymphocytes. PMID:14562047
A high level of KIR3DL2 allelic polymorphism has been identified. PMID:15304002
Receptor is a marker for the diagnosis of Sezary syndrome. PMID:16962036
Five new alleles are reported, and four previously known ones are confirmed. PMID:17661911
observation that CD4 positive, CD7 negative T-cells are mostly CD158k negative suggests that CD158k may be able to help identify and enumerate neoplastic T-cells in Sezary syndrome PMID:18061949
Functional analysis of KIR3DL2-single positive natural killer (NK) cells reveals a subset that is hyporesponsive in individuals harboring cognate ligands HLA-A3/A11. PMID:18941190
Anti-p140 autoantibodies represent a major autoantibody subset in juvenile dermatomyositis. PMID:19479859
Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. PMID:19165527