TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Family-based whole genome analysis of a family with hereditary pulmonary alveolar proteinosis revealed a homozygous deletion that disrupts CSF2RA, CRLF2, and IL3RA gene in the pseudoautosomal region of the X chromosome in the affected child and one of asymptomatic siblings.PMID:28233860
Our data define the mechanisms by which SL-101 targets acute myeloid leukemia (AML)and warrant further investigation of the clinical application of SL-101 and other CD123-targeting strategies in AML.PMID:28096272
Data show that the N-terminal domain (NTD) of interleukin 3 receptor subunit alpha (IL3Ralpha) exhibits exquisite flexibility and a dynamic transition from a high to a low mobility state upon cytokine binding.PMID:29374162
the oncogenic events of FLT3/ITD happen at a cell stage possessing CD123PMID:27465508
Data indicate that CD123 was preferentially expressed among CD33/CD117-positive precursor-T-acute lymphoblastic leukemia (T-ALL).PMID:26474588
CD123 positivity represents a marker that can facilitate identification of the early T-cell precursor leukemia subtype, but the lack of sensitivity by immunohistochemistry limits the diagnostic utility.PMID:25906118
CD123 expression is associated with systemic mastocytosis.PMID:26678095
Human BDCA2+CD123+CD56+ dendritic cells (DCs) related to blastic plasmacytoid dendritic cell neoplasm represent a unique myeloid DC subset.PMID:25779340
CD96 and CD123 are expressed in bone marrow cells of patients with myelodysplastic syndromesPMID:26642704
High interleukin-3 receptor alpha is associated with blastic plasmacytoid dendritic cell neoplasm.PMID:25381130
High CD123 expression is associated with systemic mastocytosis.PMID:25640886
CD123+ plasmacytoid dendritic cells contribute to the sarcoidal granulomas associated with injected permanent fillers.PMID:25406851
87.8% of AMLs express CD33. Additionally, 9.4% of AMLs express CD123 without concomitant CD33 expression.PMID:24927407
Increases in CD34(+)CD38(-)CD123(+) cells may reflect malignant clonal cells with aberrant differentiation, overproliferation, and decreased apoptosis in myelodysplastic syndrome, which were similar to acute myeloid leukemia.PMID:24846193
In the present study we analyzed the expression of four cell surface antigens relevant to human hematopoiesis-CD90, CD96, CD117, and CD123-in bone marrow from pediatric acute myeloid leukemia patients and normal control subjects.PMID:24751333
We conclude the hMICL/CD123-based MFC assay is a promising MRD tool in AML.PMID:24152218
Results suggest that CD123 results suggest that CD123 chimeric antigen receptors (CARs) T cells are a promising immunotherapy for the treatment of high-risk acute myeloid leukemia (AML).PMID:24030378
CD123 is a useful immunohistochemical marker to facilitate diagnosis of acute graft-versus-host disease in colon.PMID:23791208
CD123 expression in acute myeloid leukemia is associated with underlying FLT3 and NPM1 mutations.PMID:22914610
We recommend immunohistochemical analyses for CD123, CD56 and CD4 inblastic plasmacytoid dendritic cell neoplasm patients, particularly in cases where the initial bone marrow study indicates normal morphology.PMID:23470050
we report that IL3 receptor alpha (IL3Ralpha) and NOTCH play integral roles in the host cell type-specific regulation of PROX1 by Kaposi sarcoma herpes virusPMID:22719258
High levels of CD34+CD38low/-CD123+ blasts are predictive of an adverse outcome in acute myeloid leukemiaPMID:21933861
The pattern of CD123 staining can be a useful feature to distinguish hypertrophic lupus erythematosus, squamous cell carcinoma and hypertrophic actinic keratosis.PMID:21955314
These findings support the usefulness of CD123 and CD103 to aid in the differential diagnosis of B-cell lymphoproliferative disordersPMID:21917686
assessment of CD123 expression is useful for supporting the diagnosis of classical Hodgkin lymphomaPMID:20809502
Over expression of IL-3Ralpha and truncated mutation of hbetac may be involved in proliferation and differentiation block in NB4 cells.PMID:21176354
Interleukin 3 receptor alpha is a cell-surface marker present on leukemia-initiating cells of patients with Fanconi anemia-acute myeloid leukemia, and may be a promising therapeutic target for these patients.PMID:21330473
CD123 was highly expressed in the bone marrow of the patients with myelodysplastic syndrome, significantly correlated with the proportion of bone marrow blasts, and thus might be the marker of MDS malignant clone.PMID:20819538
Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood.PMID:20888334
Data show high expression of CD86 and CD11C, moderate expression of CD1a and CD123, low levels of CD83 on dendritic cells after induction by GM-CSF and IL-4.PMID:19257981
Elevated expression in acute myelogenous leukemia is associated with enhanced blast proliferation, increased cellularity, and poor prognosisPMID:12351411
Bioinformatic study of IL-3 Ralpha & GM Ralpha subunits found a tripeptide sequence near the conserved proline-rich domain which was a key difference between them. Cross-exchange of equivalent subunits altered function compared to wild-type receptors.PMID:12384414
Analysis of the 5' promoter of the hIL-3Ra gene.PMID:12504125
IL-3Ralpha mRNA is upregulated by IL-3, IL-5, and GM-CSF in human eosinophilsPMID:12943658
IL-3 receptor activation is not essential for BCR-ABL-induced myeloproliferative diseasesPMID:14500898
REVIEWS overexpression of the IL-3Ralpha chain as one of the mechanisms contributing to the development of a highly malignant leukemic phenotype and evidence that IL-3Ralpha is a marker of leukemic stem cellsPMID:14671644
Therefore, these data provide strong evidence that integrin-dependent STAT5A activation controls IL-3-mediated proliferation.PMID:15795318
role in modulating tumor neovascularization in conjunction with VEGFR (KDR)PMID:16007196
Sequencing of interleukin 3 receptor alpha in an independent case-control cohort revealed both common intronic haplotypes and several novel, rare missense variants associated with schizophrenia.PMID:17522711
variants in the gene coding for its receptor (IL-23R) are strongly associated with Crohn's diseasePMID:18047539
A small but significant contribution of the IL3RA polymorphism to susceptibility to schizophrenia, suggesting that the IL3 pathway may be involved in schizophrenia.PMID:18547720
CD123+ MDCs were an early-stage immature DC subset, with a significant tumor-inhibiting activity partially via involvement of enhanced cytoplasmic TRAIL.PMID:18555589
our family-based association study revealed a small but significant contribution of the IL3RA variants to susceptibility to schizophrenia in a Chinese population (Han)PMID:19281803
overexpression of CD123 is an aberrant phenotype present in a subset of precursor-B ALL with hyperdiploid genotypePMID:19454491
Progression of cutaneous squamous cell carcinoma in immunosuppressed patients is associated with reduced CD123+ and FOXP3+ cells in the perineoplastic inflammatory infiltrate.PMID:19614769
the less mature hematogones (dim CD45+) that express CD34 lack CD123 expression, whereas the more mature hematogones (moderate CD45+) lack CD34 but always express CD123.PMID:19762535