Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA;CD123
Species
Homo sapiens (Human)
Expression Region
19-305aa
Target Protein Sequence
TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description
IL3RA (CD123) serves as a critical marker in acute myeloid leukemia and blastic plasmacytoid dendritic cell neoplasm, making it a priority target for therapeutic antibody development and cancer immunotherapy research. This mammalian-expressed extracellular domain (aa 19–305) demonstrates sub-nanomolar binding affinity (KD = 0.202 nM) to a recombinant antibody as measured by surface plasmon resonance, confirming native-like conformational integrity essential for accurate epitope mapping and therapeutic antibody validation studies. The protein supports competitive inhibition assays and blocking antibody screening, with functional ELISA data showing an EC50 of 1.254–1.412 ng/mL when capturing anti-IL3RA antibodies—quantitative benchmarks that enable reliable dose-response characterization in drug discovery campaigns targeting CD123-positive malignancies. Endotoxin levels below 1.0 EU/μg and purity exceeding 90% align with standards expected in ligand-binding assays, SPR affinity measurements, and biolayer interferometry experiments where low background interference is critical for detecting specific receptor-antibody interactions.
