Recombinant Human Integrin beta-8 (ITGB8)

Code: CSB-CF011892HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7934

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ITGB8

Uniprot NO.

P26012

Alternative Names

ITGB8; Integrin beta-8

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

43-769

Target Protein Sequence

EDNRCASSNAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Integrin alpha-V:beta-8 (ITGAV:ITGB8) is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligands. Integrin alpha-V:beta-6 (ITGAV:ITGB6) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation on the surface of activated regulatory T-cells (Tregs) (Probable). Required during vasculogenesis.

Gene References into Functions

ITGB8 is identified as a novel target of miR-26a-5p. PMID:29746867
our results indicate that miR-199a-3p enhances cisplatinsensitivity of ovarian cancer cells through downregulating ITGB8 expression, and miR-199a-3p may serve as a therapeutic target for the treatment of ovarian cancer patients with cisplatin-resistance. PMID:29436681
In cellular model, the microRNA-513a-3p was identified as a novel element targeting ITG-beta8, thereby controlling the protein level and its molecular function in the controlling of migration and pro-inflammatory environment. PMID:29204818
Among Greek and Polish patients with intracerebral hemorrhage, heterozygous individuals with the rs10251386 and the rs10239099 of the ITGB8 gene had significantly lower age of ICH onset compared to the wild-type genotypes. PMID:27476161
The results demonstrated that the hsa_circ_0046701/miR-142-3p/ITGB8 axis might play critical regulatory roles in the pathogenesis and development of glioma. PMID:29337055
Integrin beta8 was differentially expressed between Fibromyalgia patients and healthy controls. PMID:27157394
Integrin Beta8 plays a role in the motility of prostate cancer cells. PMID:25886373
data show that integrin beta 8, but not integrin beta 5 or integrin beta 6, protein expression is increased in liver specimens of patients with biliary atresia PMID:25079481
Brain metastases ITGB8 expression exhibits considerable heterogeneity according to tumor origin. PMID:24294359
Desmoglein-2 co-localizes with integrin-beta8 in N-MVECs. PMID:23874518
ITGB8 silencing may change lung cancer cells to a less invasive phenotype through alteration in the expression of metastasis-related genes. PMID:22753015
Deletion of the Itgb8 gene from retinal ganglia cells and Mu ller glia, but not astrocytes, results in highly abnormal vascular patterning and instability. PMID:22279205
Highly angiogenic and poorly invasive glioblastomas expressed low levels of beta8 integrin, whereas highly invasive glioblastomas with limited neovascularization expressed high levels of beta8 integrin. PMID:21859829
Interleukin-1beta induces increased transcriptional activation of the transforming growth factor-beta-activating integrin subunit beta8 through altering chromatin architecture. PMID:21878622
miR-93 promotes the growth of, and angiogenesis in astrocytomas, by suppressing, at least in part, integrin-beta8 expression. PMID:20956944
Transcription of the transforming growth factor beta activating integrin beta8 subunit is regulated by SP3, AP-1, and the p38 pathway PMID:20519498