Home
Product
Protein
Transmembrane Proteins
Recombinant Human G-protein coupled receptor family C group 5 member C (GPRC5C)

Recombinant Human G-protein coupled receptor family C group 5 member C (GPRC5C)

Code: CSB-CF878851HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5622

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GPRC5C

Uniprot NO.

Q9NQ84

Alternative Names

GPRC5C; RAIG3; PSEC0087; G-protein coupled receptor family C group 5 member C; Retinoic acid-induced gene 3 protein; RAIG-3

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

24-441

Target Protein Sequence

QGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAGIVTTFVLTIILVASLPFVQDTKK RSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRRFLFGVLFAICFSCLAAHVFALNF LARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLVRGSGEGGPQGNSSAGWAVASPCA IANMDFVMALIYVMLLLLGAFLGAWPALCGRYKRWRKHGVFVLLTTATSVAIWVVWIVMY TYGNKQHNSPTWDDPTLAIALAANAWAFVLFYVIPEVSQVTKSSPEQSYQGDMYPTRGVG YETILKEQKGQSMFVENKAFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPS EGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways.

Gene References into Functions

Data suggest that agents (such as all-trans retinoic acid) that activate GPRC5C restore and/or maintain functional insulin-secreting cells; GPRC5C appears to play role in regulation of expression of genes controlling apoptosis, cell survival, and cell proliferation in insulin-secreting cells. PMID:28228611

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Localized in the plasma membrane and perinuclear vesicles.

Protein Families

G-protein coupled receptor 3 family

Tissue Specificity

Expression is highest in the periphery, particularly in the stomach, but also in the kidney, liver, pancreas, and prostate. In brain, levels of expression are generally lower than in the periphery, with the exception of cerebellum, spinal cord, and dorsal

Database Links

HGNC: 13309

UNIGENE: Hs.446438

KEGG: hsa:55890

STRING: 9606.ENSP00000376403

OMIM: 605949

Promotions